BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0070 (774 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1231 + 25047067-25047262,25047876-25048045,25048897-250490... 29 4.1 08_01_0141 - 1115794-1117584,1117803-1117897,1119557-1119821 28 7.2 01_01_0094 - 730484-731570,732030-732715 28 7.2 11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840,377... 28 9.5 06_03_0099 + 16633928-16638213,16638299-16638386,16638823-166389... 28 9.5 05_02_0003 + 5520331-5520476,5520572-5520644,5520762-5520928,552... 28 9.5 01_06_1087 - 34430521-34430899,34432336-34432806,34432926-344331... 28 9.5 >07_03_1231 + 25047067-25047262,25047876-25048045,25048897-25049030, 25049122-25049369,25049799-25049904,25049992-25050130, 25050258-25050385,25050472-25050733 Length = 460 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -1 Query: 519 LLTKLAHLAPSSDLRLHRSSKPEFSPI 439 +L L +LAP DLR+ SSKP F I Sbjct: 258 MLETLVNLAPVLDLRIFSSSKPSFIKI 284 >08_01_0141 - 1115794-1117584,1117803-1117897,1119557-1119821 Length = 716 Score = 28.3 bits (60), Expect = 7.2 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = -1 Query: 612 CCHERPTPFMVSHERFLGALTLRLVHPTAPVLLTKL 505 C E PF HE ALTL + PTA L+ KL Sbjct: 324 CIRELAVPFF-HHEVVKRALTLGMESPTAEALIVKL 358 >01_01_0094 - 730484-731570,732030-732715 Length = 590 Score = 28.3 bits (60), Expect = 7.2 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -1 Query: 645 LSGFRLPWPPSCCHERPTPFMVSHERFLGALT 550 + G +LP P C + P P +V RF LT Sbjct: 552 VDGLQLPSRPFFCDDEPLPLLVDSYRFSSELT 583 >11_01_0489 + 3776563-3776692,3776995-3777073,3777532-3777840, 3778828-3778898,3778975-3779213,3779306-3779383, 3779734-3780156,3780416-3780661,3780886-3780978, 3781480-3781527 Length = 571 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 255 KSIVGTGYRGERLIEPSSSWFRPKFPSG 338 + + GTG + PSS+WF P+ SG Sbjct: 12 RCVFGTGPLPPASLSPSSAWFDPELSSG 39 >06_03_0099 + 16633928-16638213,16638299-16638386,16638823-16638950, 16640008-16640278 Length = 1590 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Frame = -1 Query: 681 GWLLRQVSRCTLLSGFRL---PWPPSCCHER 598 G+LLR + LLS RL P PP CCH R Sbjct: 63 GYLLRHSAHFLLLSA-RLRPPPPPPRCCHRR 92 >05_02_0003 + 5520331-5520476,5520572-5520644,5520762-5520928, 5520929-5521223,5521531-5521674,5521756-5521890, 5522004-5522093,5523702-5523809,5523905-5523986, 5525362-5525417,5525888-5525986,5526090-5526394, 5526898-5527075,5527167-5527280,5527376-5527507, 5527614-5527718 Length = 742 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = +2 Query: 518 RTGAVG*TKRSVKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRLTCRSNQP 682 +TG G KR +KA +K S+D + R QQ G + + + ++Q+ +S P Sbjct: 267 KTGDFG--KRPIKAMEKLSYDAICSGARCIQQQGNNSNMSRSDALQQYHSKSFNP 319 >01_06_1087 - 34430521-34430899,34432336-34432806,34432926-34433112, 34433470-34433599,34433794-34434125,34434566-34435050, 34435185-34435752,34436579-34436640,34437569-34437636 Length = 893 Score = 27.9 bits (59), Expect = 9.5 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 436 KFENRLRSFRPQCL*SFALPDETVLKFYIDASYPEGNF-GRNQLLDGSISLSPLY 275 K E LRSF + LP K+ I A++ GN+ GRN GS L L+ Sbjct: 93 KQEETLRSFPDGQRNCYTLPTNRSKKYLIRATFTYGNYDGRNSSESGSPFLFGLH 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,948,508 Number of Sequences: 37544 Number of extensions: 505756 Number of successful extensions: 1105 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2068401984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -