BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0070 (774 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) 72 5e-13 SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 5e-13 SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 2e-08 SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 4e-07 SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) 51 9e-07 SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 48 1e-05 SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) 43 3e-04 SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.021 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_41657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 29 4.2 SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) 29 5.5 SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_49641| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 >SB_30216| Best HMM Match : TIL (HMM E-Value=3.1) Length = 212 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 607 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_14965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 607 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_6863| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 72.1 bits (169), Expect = 5e-13 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +1 Query: 607 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 TAGRWPWK ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 80 TAGRWPWKLESAKECVTTHLPKQLALKMDGAQASHLYRAV 119 >SB_27787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 56.8 bits (131), Expect = 2e-08 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +1 Query: 607 TAGRWPWKSESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 TAGR + ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 1 TAGRVAMEVESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_53289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 628 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 9 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 41 >SB_49224| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 628 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_27353| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 52.4 bits (120), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 628 KSESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 K ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 2 KLESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_58055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_54389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_51835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_48809| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_41857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_40435| Best HMM Match : DUF1677 (HMM E-Value=4.2) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_9214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_5959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_3984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 4 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_47626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 51.2 bits (117), Expect = 9e-07 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = +1 Query: 634 ESAKECATTHLPKQPALKMDGAEAFCLYTTV 726 ESAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 10 ESAKECVTTHLPKQLALKMDGAQASHLYRAV 40 >SB_55300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 637 SAKECATTHLPKQPALKMDGAEAFCLYTTV 726 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_53216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 637 SAKECATTHLPKQPALKMDGAEAFCLYTTV 726 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_24856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 637 SAKECATTHLPKQPALKMDGAEAFCLYTTV 726 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_16637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 49.2 bits (112), Expect = 4e-06 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +1 Query: 637 SAKECATTHLPKQPALKMDGAEAFCLYTTV 726 SAKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 5 SAKECVTTHLPKQLALKMDGAQASHLYRAV 34 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 551 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 661 ++ +RS D KGVG S QQDGGHGS NPLR QRL Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLRKGQRL 45 >SB_49647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 47.6 bits (108), Expect = 1e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = +1 Query: 640 AKECATTHLPKQPALKMDGAEAFCLYTTV 726 AKEC TTHLPKQ ALKMDGA+A LY V Sbjct: 39 AKECVTTHLPKQLALKMDGAQASHLYRAV 67 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = +2 Query: 551 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 646 ++ +RS D KGVG S QQDGGHGS NP + Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPAK 40 >SB_13467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -1 Query: 246 NRYGPPSGFPLTST*PGIVHHLSGPSICA 160 NRY PP FPL S GIVHHLSGP+ CA Sbjct: 1 NRYEPPPEFPLASPYSGIVHHLSGPNRCA 29 >SB_20402| Best HMM Match : Transformer (HMM E-Value=2.1) Length = 276 Score = 42.7 bits (96), Expect = 3e-04 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = -3 Query: 544 FGSSHSASSAYQIGPLGTVIRSPASSFE*AGVLTHLKFENR 422 FGSS ASS YQ GP T I P + + G+LT+LKFENR Sbjct: 78 FGSSRIASSGYQNGPTRTRIHCPGFNKQ-VGLLTNLKFENR 117 >SB_7775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 42.7 bits (96), Expect = 3e-04 Identities = 21/30 (70%), Positives = 23/30 (76%) Frame = -3 Query: 247 ESLRSSIRVSPDFDLTRHSSPSFGSQHLCS 158 ESLR+S RVS F L RHSSPSFGSQ + S Sbjct: 35 ESLRASTRVSSGFTLFRHSSPSFGSQQMRS 64 >SB_6844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 42.3 bits (95), Expect = 4e-04 Identities = 21/29 (72%), Positives = 21/29 (72%) Frame = -3 Query: 556 LNTTFGSSHSASSAYQIGPLGTVIRSPAS 470 LN FGSS ASSAYQ GPLGT I PAS Sbjct: 17 LNRAFGSSRIASSAYQNGPLGTRIHCPAS 45 >SB_5602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 6e-04 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +2 Query: 551 VKAPKKRSWDTMKGVGRS*QQDGGHGSRNPLR 646 ++ +RS D KGVG S QQDGGHGS NPL+ Sbjct: 9 LRCQSRRSSDPTKGVGCSRQQDGGHGSWNPLK 40 Score = 41.9 bits (94), Expect = 6e-04 Identities = 20/28 (71%), Positives = 21/28 (75%) Frame = +1 Query: 643 KECATTHLPKQPALKMDGAEAFCLYTTV 726 KEC TT LPKQ ALKMDGA+A LY V Sbjct: 40 KECVTTPLPKQLALKMDGAQASHLYRAV 67 >SB_29359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 33 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = +3 Query: 567 NAHGTP*KALVAHDSRTVAMEVGIR 641 +AH TP K LVA DSRTVAMEVGIR Sbjct: 9 DAHQTPQKVLVALDSRTVAMEVGIR 33 >SB_24059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +1 Query: 628 KSESAKECATTHLPKQPALKM 690 K ESAKEC TTHLPKQ ALKM Sbjct: 2 KVESAKECVTTHLPKQLALKM 22 >SB_52007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 36.7 bits (81), Expect = 0.021 Identities = 32/72 (44%), Positives = 34/72 (47%) Frame = -3 Query: 715 IGKTLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLNTTFGS 536 IG TL+RHPFSGLVASA + PT F G LN FGS Sbjct: 24 IGATLERHPFSGLVASAEQ--------PT------------PFVGSDERRLWHLNRAFGS 63 Query: 535 SHSASSAYQIGP 500 S ASSAYQ P Sbjct: 64 SRIASSAYQKWP 75 >SB_9493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 36.7 bits (81), Expect = 0.021 Identities = 32/72 (44%), Positives = 34/72 (47%) Frame = -3 Query: 715 IGKTLQRHPFSGLVASAGESLHTP*RIPTSMATVLLS*ATNAFHGVP*AFFRRLNTTFGS 536 IG TL+RHPFSGLVASA + PT F G LN FGS Sbjct: 22 IGATLERHPFSGLVASAEQ--------PT------------PFVGSDERRLWHLNRAFGS 61 Query: 535 SHSASSAYQIGP 500 S ASSAYQ P Sbjct: 62 SRIASSAYQKWP 73 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -1 Query: 246 NRYGPPSGFPLTST*PGIVHH 184 NRY PP FPL S GIVHH Sbjct: 1 NRYEPPPEFPLASPYSGIVHH 21 >SB_40592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = -3 Query: 556 LNTTFGSSHSASSAYQIGP 500 LN FGSS ASSAYQ GP Sbjct: 17 LNRAFGSSRIASSAYQKGP 35 >SB_41657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 450 Score = 29.1 bits (62), Expect = 4.2 Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 3/94 (3%) Frame = -1 Query: 609 CHERPTPFMVSHERFLGALTLRLVHPTAPVLLTKLAH---LAPSSDLRLHRSSKPEFSPI 439 CH+R P +V LGAL LR+ A + AH AP L+ + K + S + Sbjct: 243 CHKRDVPVLVDGAHALGALPLRIAELGADYYVAN-AHKWLCAPKGCAALYVADKHKGS-V 300 Query: 438 *SLRIG*GRFGPNASNHSLYRMRLF*NFISTPAI 337 L + G FG + L+R+ F +S I Sbjct: 301 RCLTVS-GGFGRGFTTEFLFRVLDFWETVSPDRI 333 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 659 VVAHSLADSDFHGHRPAVMSDQRLSWCPMSVF 564 + H + ++DF G R A+M+D +L C S+F Sbjct: 386 LTTHFMDEADFLGDRIAIMADGQLRCCGSSLF 417 >SB_36629| Best HMM Match : Fer2 (HMM E-Value=0.0041) Length = 128 Score = 28.7 bits (61), Expect = 5.5 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +3 Query: 114 LPRRLVSNQ*MKARSEHKC----WDPKDGELCLVRSKSGETLMEDRSDSDV 254 L RR VSN + +++H+ + +DG+ V++K G++L++ D+DV Sbjct: 29 LARRYVSNGKEQTKAKHETVSITFVDRDGDRQTVKAKVGDSLLDVAKDNDV 79 >SB_19053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 28.7 bits (61), Expect = 5.5 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 506 WPTWHRHQISGFIVRVSRSSHPFKV 432 WPT + H +SGF SR+S+ FKV Sbjct: 34 WPTRNSHSLSGFNY-ASRTSYQFKV 57 >SB_49641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 755 Score = 28.3 bits (60), Expect = 7.3 Identities = 16/65 (24%), Positives = 31/65 (47%), Gaps = 2/65 (3%) Frame = -1 Query: 657 RCTLLSGFRLPWPPSCCHERPTPFMVSHE-RFLGALTLRLVHPTAPVLLTKL-AHLAPSS 484 +C L P PT + ++ RF +T+ L+HP +PV+ ++ A + Sbjct: 183 KCGLCGSTPTPTEKPSSPSLPTTKVTKNDARFCSEITVLLLHPLSPVIRSRSDARIVIFE 242 Query: 483 DLRLH 469 D+++H Sbjct: 243 DVKMH 247 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,552,721 Number of Sequences: 59808 Number of extensions: 544955 Number of successful extensions: 1248 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 1133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1247 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -