BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0070 (774 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g74690.1 68414.m08650 calmodulin-binding family protein low s... 29 2.6 At1g54730.3 68414.m06241 sugar transporter, putative similar to ... 29 3.4 At1g54730.2 68414.m06240 sugar transporter, putative similar to ... 29 3.4 At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA... 29 4.5 At4g08480.1 68417.m01399 mitogen-activated protein kinase, putat... 29 4.5 At1g74170.1 68414.m08590 leucine-rich repeat family protein cont... 28 6.0 At2g35890.1 68415.m04406 calcium-dependent protein kinase, putat... 28 7.9 At2g27810.2 68415.m03372 xanthine/uracil permease family protein... 28 7.9 At2g27810.1 68415.m03371 xanthine/uracil permease family protein... 28 7.9 >At1g74690.1 68414.m08650 calmodulin-binding family protein low similarity to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 587 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = -3 Query: 502 PLGTVIRSPASSFE*AGVLTHLKFENRLRSFR 407 P +V + PAS+FE + V T +FE RSFR Sbjct: 282 PKKSVRKVPASNFESSSVQTSFEFEKPKRSFR 313 >At1g54730.3 68414.m06241 sugar transporter, putative similar to ERD6 protein [Arabidopsis thaliana] GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 332 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 483 LMTVPSGPIW*AELALWDEPNVVLRRLK 566 L +P P W A++ W+E + L+RL+ Sbjct: 119 LFVIPESPRWLAKVGKWEEFEIALQRLR 146 >At1g54730.2 68414.m06240 sugar transporter, putative similar to ERD6 protein [Arabidopsis thaliana] GI:3123712, sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 470 Score = 29.1 bits (62), Expect = 3.4 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 483 LMTVPSGPIW*AELALWDEPNVVLRRLK 566 L +P P W A++ W+E + L+RL+ Sbjct: 201 LFVIPESPRWLAKVGKWEEFEIALQRLR 228 >At4g33370.1 68417.m04744 DEAD-box protein abstrakt, putative RNA helicase DBP2 - Saccharomyces cerevisiae, PID:g5272 Length = 542 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +3 Query: 201 VRSKSGETLMEDRSDSDVKSIVGTGYRGERLIEPSSSWFRP 323 V + G+ +ME SD VG RG EP S+W++P Sbjct: 24 VVEEPGKGMMEHLSDKKKLMSVGELARGITYTEPLSTWWKP 64 >At4g08480.1 68417.m01399 mitogen-activated protein kinase, putative similar to mitogen-activated protein kinase [Arabidopsis thaliana] gi|1255448|dbj|BAA09057; contains Pfam PF00069: Protein kinase domain Length = 773 Score = 28.7 bits (61), Expect = 4.5 Identities = 16/69 (23%), Positives = 28/69 (40%) Frame = -3 Query: 361 KFYIDASYPEGNFGRNQLLDGSISLSPLYPVPTIDFTSESLRSSIRVSPDFDLTRHSSPS 182 K +D+ E G + + P+ +P +D S +PD ++ R S S Sbjct: 375 KEVVDSGTVENRRGIKGVRPSVLKPPPVMKLPPVDLPGSSWDILTHFAPDSEIVRRPSSS 434 Query: 181 FGSQHLCSE 155 S++ C E Sbjct: 435 SSSENGCDE 443 >At1g74170.1 68414.m08590 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 1068 Score = 28.3 bits (60), Expect = 6.0 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 4/78 (5%) Frame = -1 Query: 720 SV*AKRFSAIHFQ--GWLLRQVSRCTLL-SGFRLPWPPSCCHERPTPFM-VSHERFLGAL 553 +V +F+ + Q GW+L + L +GF+ P S + + F+ +SH RF G L Sbjct: 501 NVSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPSSLDNMKSIEFLDLSHNRFHGKL 560 Query: 552 TLRLVHPTAPVLLTKLAH 499 R + + + KL+H Sbjct: 561 PRRFLKGCYNLTILKLSH 578 >At2g35890.1 68415.m04406 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK). [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 520 Score = 27.9 bits (59), Expect = 7.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 604 MTAGRWPWKSESAKECATTHLPKQPALKMDGAEAFC 711 +T+ WP SESAK+ L + P ++ + C Sbjct: 351 LTSDPWPQVSESAKDLIRKMLERNPIQRLTAQQVLC 386 >At2g27810.2 68415.m03372 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 660 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 560 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 661 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 >At2g27810.1 68415.m03371 xanthine/uracil permease family protein contains Pfam profile: PF00860 permease family Length = 709 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +2 Query: 560 PKKRSWDTMKGVGRS*QQDGGHGSRNPLRSVQRL 661 P KR D+ VGRS DG +GS +P+R R+ Sbjct: 114 PVKRRRDSDGVVGRSNGPDGANGSGDPVRRPGRI 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,248,308 Number of Sequences: 28952 Number of extensions: 384699 Number of successful extensions: 908 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 908 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1726528800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -