BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0069 (451 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 73 1e-13 SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 1e-13 SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_13289| Best HMM Match : DUF543 (HMM E-Value=10) 28 4.1 SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_43698| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) 27 7.2 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 27 7.2 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 72.5 bits (170), Expect = 1e-13 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 111 TGLSLNSYILKIQFFTIFIGVNITFFPQHFLGLAGIPRRYSDYPDSY 251 TG N KI F+ +FIGVNITFFPQHFLGLAG PRRYSD+ D Y Sbjct: 105 TGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFADGY 151 Score = 35.5 bits (78), Expect = 0.020 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = +1 Query: 1 DITLHDTYYVVAHFH 45 D+ +HDTYYVVAHFH Sbjct: 68 DVVMHDTYYVVAHFH 82 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 380 SIE*YQNLPPAEHSYNELPIL 442 S+E Q PPA H+YNELP + Sbjct: 199 SLEWVQQSPPALHTYNELPFV 219 >SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 72.5 bits (170), Expect = 1e-13 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +3 Query: 111 TGLSLNSYILKIQFFTIFIGVNITFFPQHFLGLAGIPRRYSDYPDSY 251 TG N KI F+ +FIGVNITFFPQHFLGLAG PRRYSD+ D Y Sbjct: 19 TGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFADGY 65 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 380 SIE*YQNLPPAEHSYNELPIL 442 S+E Q PPA H+YNELP + Sbjct: 113 SLEWVQQSPPALHTYNELPFV 133 >SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 195 HFLGLAGIPRRYSDYPDSY 251 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 380 SIE*YQNLPPAEHSYNELPIL 442 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 195 HFLGLAGIPRRYSDYPDSY 251 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 >SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 195 HFLGLAGIPRRYSDYPDSY 251 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 380 SIE*YQNLPPAEHSYNELPIL 442 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 195 HFLGLAGIPRRYSDYPDSY 251 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 380 SIE*YQNLPPAEHSYNELPIL 442 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 195 HFLGLAGIPRRYSDYPDSY 251 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 380 SIE*YQNLPPAEHSYNELPIL 442 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 39.1 bits (87), Expect = 0.002 Identities = 15/19 (78%), Positives = 16/19 (84%) Frame = +3 Query: 195 HFLGLAGIPRRYSDYPDSY 251 HFLGLAG PRRYSD+ D Y Sbjct: 1 HFLGLAGFPRRYSDFADGY 19 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +2 Query: 380 SIE*YQNLPPAEHSYNELPIL 442 S+E Q PPA H+YNELP + Sbjct: 67 SLEWVQQSPPALHTYNELPFV 87 >SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 29.9 bits (64), Expect = 1.0 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = +2 Query: 98 ISFIYRPFIKFLYTKNSIFYNIYWSK--YNIFSTTFFRFSWNT 220 + FIY + FL +KN F+ YW+ YN F W T Sbjct: 14 VGFIYVAKVVFLLSKNKSFFFEYWTPVVYNAFGQRSPNSRWRT 56 >SB_13289| Best HMM Match : DUF543 (HMM E-Value=10) Length = 319 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 369 ISHHQLNDIKIYHQQNIHIMNYQF 440 I+HHQ + I I H Q+ I+NY + Sbjct: 296 INHHQSSSIIINHHQSSSIINYYY 319 >SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 27.5 bits (58), Expect = 5.4 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +3 Query: 165 IGVNITFFPQHFLGLAGIPRRYSDYPDSYIHEI*FL 272 IG++ HFL L GIP R YP SY H + FL Sbjct: 629 IGLSSYHRVSHFL-LLGIPLRIIGYPTSY-HRVVFL 662 >SB_43698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 27.5 bits (58), Expect = 5.4 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +3 Query: 174 NITFFPQHFLGLAGIPRRY 230 +I F +H+L + G+PRRY Sbjct: 174 SIRFLVEHYLDIQGVPRRY 192 >SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) Length = 1332 Score = 27.1 bits (57), Expect = 7.2 Identities = 14/53 (26%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 108 FTGLSLNSYIL-KIQFFTIFIGVNITFFPQHFLGLAGIPRRYSDYPDSYIHEI 263 ++ + + Y L K QF +F+ + FF +G+AG P + S +H++ Sbjct: 996 YSTIQMRLYTLTKRQFVMVFVAFFVAFFVTLIIGIAG-PAIIVSHEKSAVHQL 1047 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 229 YRRGIPAKPKKCCGKNVIFTP 167 Y R I A+ K+C GKNV+ P Sbjct: 120 YFRAIIARCKECLGKNVVLIP 140 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,517,055 Number of Sequences: 59808 Number of extensions: 149603 Number of successful extensions: 271 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 240 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -