BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0065 (681 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 3.8 At3g15710.1 68416.m01991 signal peptidase, putative similar to S... 28 5.0 At1g67970.1 68414.m07764 heat shock factor protein, putative (HS... 28 6.6 At3g44800.1 68416.m04826 meprin and TRAF homology domain-contain... 27 8.7 At1g06460.1 68414.m00684 31.2 kDa small heat shock family protei... 27 8.7 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -1 Query: 666 RAKAGLIQMFSTHRDCESTAYRSFSIK 586 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At3g15710.1 68416.m01991 signal peptidase, putative similar to SP|P13679 Microsomal signal peptidase 21 kDa subunit (EC 3.4.-.-) {Canis familiaris}; contains Pfam profile: PF00461 signal peptidase I Length = 180 Score = 28.3 bits (60), Expect = 5.0 Identities = 18/62 (29%), Positives = 29/62 (46%) Frame = +2 Query: 125 VSRFECETRLVKSHCLEPPDSRGSTVSISLPDSARLASALEAFSIIPRMVASHHRPLGRV 304 V+ E +V S +EP RG + + + D A + FS+ R + HR + +V Sbjct: 43 VTGSESPVVVVLSESMEPGFQRGDILFLRMTDEPIRAGEIVVFSVDGREIPIVHRAI-KV 101 Query: 305 HE 310 HE Sbjct: 102 HE 103 >At1g67970.1 68414.m07764 heat shock factor protein, putative (HSF5) / heat shock transcription factor, putative (HSTF5) identical to heat shock transcription factor 5 (HSF5) SP:Q9S7U5 from [Arabidopsis thaliana]; contains Pfam profile: PF00447 HSF-type DNA-binding domain Length = 374 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -1 Query: 291 GRWCEATIRGIMLNASKAEASLAESGKDMLTVEPRESGGSKQCD 160 G W + + +K + ++ + GKD LT+E E G+ + D Sbjct: 286 GAWEKLLLLSPSRKKTKKQENIVKKGKDDLTLEEEEEDGTMELD 329 >At3g44800.1 68416.m04826 meprin and TRAF homology domain-containing protein / MATH domain-containing protein Length = 564 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 14 EPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSRFECETRLVKSH 166 +PR R LY D + + + K+T S+D+ NG + S+ E R+ + H Sbjct: 149 KPRKRMRLYGDGGAVSSHLHKETSSVDV---NGFQVLPSQAESVKRIFERH 196 >At1g06460.1 68414.m00684 31.2 kDa small heat shock family protein / hsp20 family protein contains Pfam profile: PF00011 Hsp20/alpha crystallin family Length = 285 Score = 27.5 bits (58), Expect = 8.7 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -2 Query: 242 RPKPA*PNPARICSLWSPESREALNNVTLLVAFRIQNAR-RDVEAHLD 102 RPK P A + ++WSP S A + + +VA + A D+ +D Sbjct: 169 RPKLDLPKLANLGTVWSPRSNVAESTHSYVVAIELPGASINDIRVEVD 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,027,017 Number of Sequences: 28952 Number of extensions: 305644 Number of successful extensions: 744 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 731 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -