BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0063 (660 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 1.2 At2g36490.1 68415.m04479 HhH-GPD base excision DNA repair family... 28 6.3 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 148 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 53 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At2g36490.1 68415.m04479 HhH-GPD base excision DNA repair family protein (ROS1) similar to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1393 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = -3 Query: 658 RAPR*DLIIEPAFFRTPAHRRYVRKRVSITAD 563 RAPR ++ + +TP R+YVRK+V ++ D Sbjct: 139 RAPRKSVVTDGQESKTPK-RKYVRKKVEVSKD 169 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,974,405 Number of Sequences: 28952 Number of extensions: 290453 Number of successful extensions: 705 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 703 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1383534864 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -