BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0062 (708 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2246| Best HMM Match : G-patch (HMM E-Value=5.5e-11) 33 0.17 SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) 29 4.9 SB_54372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) 28 8.5 >SB_2246| Best HMM Match : G-patch (HMM E-Value=5.5e-11) Length = 396 Score = 33.5 bits (73), Expect = 0.17 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +1 Query: 328 VANEYDPMWPNDYEKVAKELQAKR 399 + +EYDP+ PNDYE V ++++ KR Sbjct: 103 IEDEYDPLKPNDYEVVKEKIREKR 126 Score = 30.3 bits (65), Expect = 1.6 Identities = 11/20 (55%), Positives = 17/20 (85%) Frame = +3 Query: 648 GYGASSVAAKIMAKYGFKEG 707 G+ ++VA+ IMAKYG+K+G Sbjct: 228 GFAVNAVASSIMAKYGWKDG 247 >SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) Length = 1426 Score = 28.7 bits (61), Expect = 4.9 Identities = 9/22 (40%), Positives = 18/22 (81%) Frame = +2 Query: 47 MSLYDDLDTIKTRTTEKVAAWS 112 +SLY+D+ +++ + TEK+ AW+ Sbjct: 304 ISLYEDIQSLEAQKTEKLKAWA 325 >SB_54372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 353 GLMIMKKLQKNCKQRGFSQMTEETGWIGNE 442 GL+ +LQ NC Q GF+ G IGN+ Sbjct: 123 GLIEGSQLQANCDQNGFNARRVRIGIIGNQ 152 >SB_5034| Best HMM Match : Extensin_2 (HMM E-Value=0.0055) Length = 695 Score = 27.9 bits (59), Expect = 8.5 Identities = 17/74 (22%), Positives = 28/74 (37%) Frame = +2 Query: 5 VDFCVGEIAIQSSKMSLYDDLDTIKTRTTEKVAAWSSGIXXXXXXXXXXXAAVTQPKREA 184 +D C+ ++ K SLYD++ + R +K A + + A + PK Sbjct: 146 LDSCIARVSSSEEKSSLYDEIPSPPNRPFKKKAPLTDILSANTGLLPFAVANIPSPKPRP 205 Query: 185 LRRSTQVLTPVIDL 226 R S P L Sbjct: 206 PRASKIAAPPAPSL 219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,557,884 Number of Sequences: 59808 Number of extensions: 297707 Number of successful extensions: 626 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 623 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -