BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0059 (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3618| Best HMM Match : C2 (HMM E-Value=4.8e-23) 29 4.3 SB_5057| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58506| Best HMM Match : Vps52 (HMM E-Value=0.099) 28 7.6 >SB_3618| Best HMM Match : C2 (HMM E-Value=4.8e-23) Length = 486 Score = 28.7 bits (61), Expect = 4.3 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 84 QLTLDTIINDKSNLLENWHRLFTSILTYV 170 Q+T+D ND S + W+RL + TY+ Sbjct: 116 QVTIDLSKNDFSKVYTTWYRLLPMVSTYI 144 >SB_5057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +1 Query: 487 SLHVFF*ILTTKFFLHTFMYCSVFSFLSVVYSMISVL 597 SL V + I T+FFL F+Y + +SVV ++S L Sbjct: 148 SLSVPWLIYLTQFFLFAFVYVNTAILMSVVMILVSFL 184 >SB_58506| Best HMM Match : Vps52 (HMM E-Value=0.099) Length = 775 Score = 27.9 bits (59), Expect = 7.6 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = -3 Query: 232 TKRKMKKKVESHNRAVKHELLTYVKIEVNNLCQFSNKFD 116 T K +K+++ R V L + +++E+N QF++K D Sbjct: 358 TDVKERKQLDEEVRKVMQGLFSVLEVELNAFIQFADKLD 396 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,769,124 Number of Sequences: 59808 Number of extensions: 303888 Number of successful extensions: 575 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 546 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 574 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -