BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0055 (768 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 25 0.88 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 3.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 3.6 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 8.2 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 24.6 bits (51), Expect = 0.88 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 299 SAERPVVRSYHPRDYP 252 SA P+VRSY P YP Sbjct: 281 SAATPLVRSYAPERYP 296 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 308 FMHSAERPVVRSYHPRDY 255 F E P R+Y+P DY Sbjct: 310 FFRELEAPCPRNYNPADY 327 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 308 FMHSAERPVVRSYHPRDY 255 F E P R+Y+P DY Sbjct: 310 FFRELEAPCPRNYNPADY 327 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = +2 Query: 638 HLDQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGV 766 +L+ A+ A + ++ G R S++ + S+SPPGV Sbjct: 148 YLNAAAVAAAAQQSHRLMMTSPSGFNRASVSPLISSSSSPPGV 190 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 177,802 Number of Sequences: 336 Number of extensions: 3790 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -