BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0054 (759 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.10c |||EPS15 repeat family actin cortical patch componen... 28 1.7 SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 27 2.9 SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pom... 27 2.9 SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe... 26 6.7 SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyc... 26 6.7 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 8.9 >SPBC800.10c |||EPS15 repeat family actin cortical patch component |Schizosaccharomyces pombe|chr 2|||Manual Length = 1116 Score = 27.9 bits (59), Expect = 1.7 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Frame = -2 Query: 635 TPRL-AVSSNRITREF*T----ATTFPPRHHSARLERNTVRPPILSTGTASAQPS 486 TPR + +SN IT + T ++ P +H+S NT+R P L++ +SA S Sbjct: 718 TPRFPSFTSNGITTDKPTLPDTTSSVPTQHNSFDAMHNTLRSPSLNSNNSSAHAS 772 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.1 bits (57), Expect = 2.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 649 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMF 750 Y+C + +S G L SED ++ W K GLI+ F Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQF 162 >SPCC16A11.08 |atg20||sorting nexin Atg20|Schizosaccharomyces pombe|chr 3|||Manual Length = 534 Score = 27.1 bits (57), Expect = 2.9 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -1 Query: 675 HLRYSLTDVPPQSNSPPGS-VLEPDHAGVLNGDDVSATSPLCTLGTK 538 HLR S+ V S SPP S L+P H+ + N S+ P LG++ Sbjct: 169 HLRSSMPLVMANSLSPPSSRALKPIHS-LSNPSTASSLEPSSPLGSE 214 >SPAC19E9.01c |nup40||nucleoporin Nup40|Schizosaccharomyces pombe|chr 1|||Manual Length = 371 Score = 25.8 bits (54), Expect = 6.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 436 FRAIVAEKPLLSLFHYLLGWAEAVPVD 516 F++ +P LFHYL G+ P+D Sbjct: 312 FKSSQKHQPRNWLFHYLFGFGSTEPID 338 >SPAC343.09 |ubx3|mug39|UBX domain protein Ubx3|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 25.8 bits (54), Expect = 6.7 Identities = 24/74 (32%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = -1 Query: 573 SATSPLCTLGTKHRAPADIIDRHRFRPTE*VMKQ*K*WFFSDDRAKRSPTYATPLMSPYN 394 S +PL LG P D++ +HR E + K FS + TY P MS Sbjct: 247 SGRAPLHLLGVSMNQPIDVVVQHRM--DEDYVAPFK--PFSGKGQRLGSTYMQPRMSQMP 302 Query: 393 ARL-ESSSTGSSFP 355 L +ST SS P Sbjct: 303 GGLYTDTSTSSSVP 316 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 8.9 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = -3 Query: 241 GYLKRVIVTPAVYPRLLEFLHVDIQST 161 G+++R+ V YP LLE+L++ + S+ Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS 102 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,053,595 Number of Sequences: 5004 Number of extensions: 60925 Number of successful extensions: 165 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 161 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 363302114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -