BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0054 (759 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_1065 + 30061588-30061883,30061995-30062056,30062196-300622... 32 0.43 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 31 1.00 05_02_0152 + 7126802-7127315,7127451-7129190,7130718-7131778 30 1.7 03_04_0006 + 16257288-16259522 30 2.3 06_03_0854 + 25400855-25403741,25406174-25407708 29 4.0 07_03_1671 + 28512585-28513424 28 7.0 12_02_0077 - 13288916-13289659,13289689-13289691 28 9.3 12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776,555... 28 9.3 04_04_0433 + 25163111-25163471,25163943-25164154,25164420-251647... 28 9.3 04_01_0416 - 5504415-5504590,5509032-5509116,5509190-5509322,550... 28 9.3 >03_05_1065 + 30061588-30061883,30061995-30062056,30062196-30062276, 30062391-30062464,30062547-30062629,30063044-30063147, 30063526-30063665,30063736-30063783,30063939-30063991, 30064178-30064262,30064346-30064412,30064496-30064606, 30065262-30065283,30066244-30071110,30071186-30071374, 30071463-30071577,30072329-30073388,30074247-30074694, 30074966-30075019,30075105-30076898,30076989-30077949, 30078271-30078384,30078459-30078613,30078934-30079026, 30079341-30079613,30093423-30093975,30094465-30094540, 30094619-30094718 Length = 4025 Score = 32.3 bits (70), Expect = 0.43 Identities = 22/75 (29%), Positives = 34/75 (45%) Frame = -1 Query: 732 SFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLNGDDVSATSPLC 553 +F P+ P LA + GH R+ + D + S G + D + + VSA + LC Sbjct: 371 AFHPYLP-----LATTSSGHRRFGMEDEIEEELSLAGIFNKGDRSYAVRRAAVSAYAALC 425 Query: 552 TLGTKHRAPADIIDR 508 + H AP + DR Sbjct: 426 AVLCAHEAPGGLPDR 440 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 31.1 bits (67), Expect = 1.00 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = -1 Query: 648 PPQSNSPPGSVLEPDHAGVLNGDDVSATSPLCTLGTKH 535 P +NS P +V +PD +LNGD++ T L + +H Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDEIQQTFELNSQEIQH 776 >05_02_0152 + 7126802-7127315,7127451-7129190,7130718-7131778 Length = 1104 Score = 30.3 bits (65), Expect = 1.7 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 6/54 (11%) Frame = +2 Query: 542 VPSVQSGD--VAETSSPFKTPA*----SGSRTLPGGEFDWGGTSVKE*RRCPKA 685 VP V + D VAE S P+ +P+ SGS P G D GG ++ R CP A Sbjct: 739 VPRVMNDDNGVAEGSPPWSSPSTRRRLSGSSAKPDGHKDGGGATLPS-RGCPAA 791 >03_04_0006 + 16257288-16259522 Length = 744 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -1 Query: 441 AKRSP---TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWE 289 A+RSP Y T L + ARL T PA SP +AV S + G W+ Sbjct: 162 ARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVSPSGKRVAVASWQGKPGLWD 215 >06_03_0854 + 25400855-25403741,25406174-25407708 Length = 1473 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -1 Query: 441 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 316 AKR+PT T P AR +++ +F +P P P +V+S Sbjct: 475 AKRAPTAVTVGAPPPQARTPAAAPAKAF-VSAPAPAPSSVIS 515 >07_03_1671 + 28512585-28513424 Length = 279 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = +2 Query: 494 GRKRCRSIISAGARCFVPSVQSGDVAETSSPFKTPA*SGSRTLPGG 631 GR+R S + PSV SGD P + P SG+ GG Sbjct: 27 GRRRLLSTSTEAGGAGDPSVHSGDPPSDDYPDRPPKFSGAEEATGG 72 >12_02_0077 - 13288916-13289659,13289689-13289691 Length = 248 Score = 27.9 bits (59), Expect = 9.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -1 Query: 384 ESSSTGSSFPADSPKPVPLAVVSLDSR 304 ++ S G S P DS + VP+ VV+L R Sbjct: 3 DNQSLGKSLPKDSRRHVPVGVVALKKR 29 >12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776, 5551329-5552345,5552523-5553344,5553528-5553800 Length = 831 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +1 Query: 40 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC*RNVISAQCS 168 C T RS N H + CL+ +H G NVI +CS Sbjct: 242 CDTERARSDTNEHNIYDGCCLLDVQHTQSFPGNGANVIPTKCS 284 >04_04_0433 + 25163111-25163471,25163943-25164154,25164420-25164701, 25164794-25164916,25165511-25165664,25165754-25165965, 25166143-25166212,25166294-25166424 Length = 514 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +1 Query: 40 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC-*RNVISAQCS 168 CT++ +R A W G G L HC P V+S +CS Sbjct: 26 CTSSSRRRASPWGGAGRLIRLRLRGHCPSPASARAARVVSPRCS 69 >04_01_0416 - 5504415-5504590,5509032-5509116,5509190-5509322, 5509426-5510312 Length = 426 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = -1 Query: 414 PLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDS 307 PL+ P AR SSTGSSFP S P ++ L S Sbjct: 47 PLIHPTPARF-ISSTGSSFPPYSEPPPSAPMLELGS 81 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,496,679 Number of Sequences: 37544 Number of extensions: 465604 Number of successful extensions: 1514 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1511 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2027850416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -