BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0054 (759 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51800.1 68418.m06423 expressed protein 31 1.1 At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 29 3.4 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 29 4.4 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 29 4.4 At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family p... 28 5.9 At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family p... 28 5.9 At4g27950.1 68417.m04010 AP2 domain-containing transcription fac... 28 5.9 >At5g51800.1 68418.m06423 expressed protein Length = 972 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +3 Query: 222 MTLLR*PNASSLISDA-HEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSLTLVW 392 M +LR P++SS I + H+W N I V + L + + ++ E +LL+ ++W Sbjct: 613 MAILRKPDSSSCIENVQHQWPNVIGYVKGFGLWRGEEADKVREGAADPSSLLAEKILW 670 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 420 ATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 310 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 28.7 bits (61), Expect = 4.4 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -3 Query: 223 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 113 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 33 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 69 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 28.7 bits (61), Expect = 4.4 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -3 Query: 223 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 113 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 32 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 68 >At5g02040.2 68418.m00125 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 258 LVTRHLATLRES*LLPPFTRACLNFFTLTFRALGRNH 148 L+ HLAT+ + L P +A N F FRA+ RN+ Sbjct: 170 LLIAHLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 >At5g02040.1 68418.m00124 prenylated rab acceptor (PRA1) family protein contains Pfam PF03208: PRA1 family protein Length = 209 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 258 LVTRHLATLRES*LLPPFTRACLNFFTLTFRALGRNH 148 L+ HLAT+ + L P +A N F FRA+ RN+ Sbjct: 170 LLIAHLATILHASLRTPNLKARFNTFREEFRAVWRNY 206 >At4g27950.1 68417.m04010 AP2 domain-containing transcription factor, putative DNA-binding protein Pti6, Lycopersicon esculentum, gb:U89257 Length = 335 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/58 (34%), Positives = 25/58 (43%) Frame = -2 Query: 656 QMYRPSQTPRLAVSSNRITREF*TATTFPPRHHSARLERNTVRPPILSTGTASAQPSK 483 ++ R S T R A S+ EF FP R + V P STG SA P+K Sbjct: 41 RLVRVSMTDRDATDSSSDEEEF----LFPRRRVKRLINEIRVEPSSSSTGDVSASPTK 94 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,539,200 Number of Sequences: 28952 Number of extensions: 343468 Number of successful extensions: 1036 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1000 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -