BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0053 (688 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43004| Best HMM Match : FAD_binding_4 (HMM E-Value=1.4e-18) 29 2.7 SB_6544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_43004| Best HMM Match : FAD_binding_4 (HMM E-Value=1.4e-18) Length = 1067 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +3 Query: 21 WNHSQLVDPLFAMAFFFDISRQRSNVPNNVPRHNNKMRC 137 W++S + F AFFF + R S P N PR+ + C Sbjct: 45 WSNS--TNKFFKSAFFFSLGRILSTCPLNRPRNRKLLAC 81 >SB_6544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 400 Score = 27.9 bits (59), Expect = 8.1 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = +3 Query: 45 PLFAMAF-----FFDISRQRSNVPNNVPRHNNK 128 PL M F F+++ RQ S + N PR N+K Sbjct: 264 PLLVMVFLNGKIFYEVLRQSSKIKKNFPRENSK 296 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,126,017 Number of Sequences: 59808 Number of extensions: 332969 Number of successful extensions: 757 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 757 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -