Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fbVm0053
         (688 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g09640.1 68418.m01115 sinapoylglucose:choline sinapoyltransfe...    27   8.8  

>At5g09640.1 68418.m01115 sinapoylglucose:choline
           sinapoyltransferase (SNG2) GC donor splice site at exon
           11 and 13; TA donor splice site at exon 10; similar to
           serine carboxypeptidase I precursor (SP:P37890) [Oryza
           sativa]; wound-inducible carboxypeptidase, Lycopersicon
           esculentum, EMBL:AF242849; contains Pfam profile
           PF00450: Serine carboxypeptidase; identical to cDNA
           sinapoylglucose:choline sinapoyltransferase (SNG2)
           GI:15418806
          Length = 465

 Score = 27.5 bits (58), Expect = 8.8
 Identities = 9/31 (29%), Positives = 18/31 (58%)
 Frame = +1

Query: 310 SNSMKAADHCSSCVLGHELSEHSCPTEYAIS 402
           SN+++A DHC S +    +   +C  +Y ++
Sbjct: 261 SNNLQAYDHCMSEIYSEHILLRNCKVDYVLA 291


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,348,654
Number of Sequences: 28952
Number of extensions: 219124
Number of successful extensions: 371
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 367
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 371
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1457719448
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)