BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0050 (555 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12457| Best HMM Match : zf-C2H2 (HMM E-Value=0.29) 29 2.6 SB_9163| Best HMM Match : XS (HMM E-Value=0.84) 29 3.4 >SB_12457| Best HMM Match : zf-C2H2 (HMM E-Value=0.29) Length = 327 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 329 IYSSGILVIPSINLNK*QQTQNYDTEMFILETKIEYQ 219 +Y SG L I NL+ Q+ +++ E ++TK+E+Q Sbjct: 286 LYRSGRLAIDQANLSPDQEEEDFVQEAEQMQTKLEFQ 322 >SB_9163| Best HMM Match : XS (HMM E-Value=0.84) Length = 424 Score = 28.7 bits (61), Expect = 3.4 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 90 CKPMCVLLVCEFNLFREK*KK 28 CKP C +L C N FR K KK Sbjct: 377 CKPNCPILCCRSNPFRVKGKK 397 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,541,649 Number of Sequences: 59808 Number of extensions: 256513 Number of successful extensions: 494 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -