BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0048 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 24 1.7 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 24 1.7 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 23 3.0 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 3.0 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 4.0 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.3 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 21 9.3 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 629 GNYSGVFLALISLLCMFNIP 570 G+YS V L + +LL +F+IP Sbjct: 76 GSYSSVSLQVANLLRLFHIP 95 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = -1 Query: 629 GNYSGVFLALISLLCMFNIP 570 G+YS V L + +LL +F+IP Sbjct: 166 GSYSSVSLQVANLLRLFHIP 185 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 23.0 bits (47), Expect = 3.0 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 257 KAHSAYPKFQPLVLQWSFHYPFHI 186 + Y +FQ L L+ FHY ++ Sbjct: 10 RGRQTYTRFQTLELEKEFHYNHYL 33 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.0 bits (47), Expect = 3.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 584 YKEDL*GPGRPRSSFRDQIYNYYQKFGYKTQVMG 685 +K ++ RPRSSF+ + Y F + V G Sbjct: 204 FKAEVGSKLRPRSSFQGPPFTYRYGFSFLLYVSG 237 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 22.6 bits (46), Expect = 4.0 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 147 VWNSISTFLIKLLNMERIMEAPLKNKWL 230 +W+ ST++ K+ N + + L+N WL Sbjct: 318 IWDYDSTYIPKVKNKKAGSKHLLQNTWL 345 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.3 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 223 LFFNGASIILSIFNSFIKNVLILFHTS 143 LF N AS+ + IFN I +L++ H S Sbjct: 268 LFLNMASVFMRIFN-LICMMLLIGHWS 293 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = +3 Query: 132 YSLLLVWNSISTFLIKLLNMERIMEAP 212 Y + L +NS+ F + +++++E+P Sbjct: 21 YFIFLYFNSLVRFRRFTIELDKVLESP 47 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 227,068 Number of Sequences: 438 Number of extensions: 5261 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -