BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0045 (630 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|ch... 29 0.55 SPBC13A2.03 |||phosphatidate cytidylyltransferase|Schizosaccharo... 27 3.0 SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr 3|||Ma... 26 3.9 SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomy... 26 5.2 SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces p... 25 9.0 SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting... 25 9.0 SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizo... 22 9.8 >SPAC31G5.09c |spk1||MAP kinase Spk1|Schizosaccharomyces pombe|chr 1|||Manual Length = 372 Score = 29.1 bits (62), Expect = 0.55 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 115 VQTTVKKIHAYSHHLFALRTL 177 ++ VKKIH ++H +F LRTL Sbjct: 63 LKVAVKKIHPFNHPVFCLRTL 83 >SPBC13A2.03 |||phosphatidate cytidylyltransferase|Schizosaccharomyces pombe|chr 2|||Manual Length = 439 Score = 26.6 bits (56), Expect = 3.0 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Frame = +1 Query: 94 RTVLWYVVQTTV-----KKIHAYSHHLFAL 168 R + WY + TT+ + I+AY HHLF + Sbjct: 109 RFINWYFLMTTLYYAYGESIYAYFHHLFIM 138 >SPCC320.04c |||GTPase Gem1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 630 Score = 26.2 bits (55), Expect = 3.9 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +1 Query: 58 IFIMLVACVASXRTVLWYVVQTTVKK--IHAYSHHLFAL 168 +F M ACV T LW + T++K IHA S F + Sbjct: 158 LFYMCRACVIYPITPLWDAKERTMRKATIHALSRIFFLI 196 >SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 606 Score = 25.8 bits (54), Expect = 5.2 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 144 IQPPLVCPKNTEHRARHAGKCACCPACVTLLGEG 245 + PPL PK+ HR AG+ + LL +G Sbjct: 334 LDPPLD-PKSFSHRCGRAGRAGRAGVAIVLLNDG 366 >SPBC947.10 |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 676 Score = 25.0 bits (52), Expect = 9.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +1 Query: 61 FIMLVACVASXRTVLWYVV 117 FI+LV C+AS + W V+ Sbjct: 470 FIILVVCIASLYSAFWPVI 488 >SPAC19G12.01c |cut20|lid1, apc4, SPAPJ698.04c|anaphase-promoting complex subunit Apc4|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 25.0 bits (52), Expect = 9.0 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -1 Query: 411 IIFRTGRDRSIASLYFPANENDYTSLVQTLLMHLR 307 +I + G + S+ +LY P +ND S+V M R Sbjct: 230 LICKGGTNISLKTLYMPLLKNDLGSIVDIATMSTR 264 >SPAC19B12.03 |bgs3||1,3-beta-glucan synthase subunit Bgs3|Schizosaccharomyces pombe|chr 1|||Manual Length = 1826 Score = 21.8 bits (44), Expect(2) = 9.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 146 YAWIFFTVVCTTYQSTV 96 Y FF++ C YQS + Sbjct: 540 YVHFFFSIGCVAYQSFI 556 Score = 21.0 bits (42), Expect(2) = 9.8 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 83 THATSIIKINVFILKFLNTFLVIVLS 6 T ++ + I VFI KF+ ++ + LS Sbjct: 593 TLLSAALWITVFIAKFVESYYFLTLS 618 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,596,431 Number of Sequences: 5004 Number of extensions: 53041 Number of successful extensions: 136 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 131 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 279695522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -