BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0044 (783 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 30 0.33 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.75 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 26 7.0 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 9.3 SPBC32F12.07c |||ubiquitin-protein ligase E3 |Schizosaccharomyce... 25 9.3 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 9.3 SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycos... 25 9.3 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 30.3 bits (65), Expect = 0.33 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +1 Query: 169 SGCGRCRVWSMFVRYVRFSELVF*YNAASKLYIF 270 +GCG+ VW +VR+V F E + LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.75 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 352 ARKIRGRPENAGPDPVRNVRRFSRV 278 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.8 bits (54), Expect = 7.0 Identities = 19/56 (33%), Positives = 32/56 (57%) Frame = -3 Query: 598 GYLKRVIVTPAVYPRLLEFLHVDIQSTGQKHIASTPARAIAMLCFN*TVGFPLSVP 431 G+++R+ V YP LLE+L++ + S+ K++ S + A L F T P+S P Sbjct: 76 GFIERISVILRDYPDLLEYLNIFLPSS-YKYLLSN-SGANFTLQFT-TPSGPVSTP 128 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 9.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 206 TNIDQTRHRPHPLPVQTRHAPV 141 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPBC32F12.07c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 340 Score = 25.4 bits (53), Expect = 9.3 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +2 Query: 602 CLVI*LVTRMNGLTRFPLSLIYY-LAKPQPRERAW 703 CL+ +TR +G TR P L Y +AKP P+E++W Sbjct: 47 CLIS-YITR-SGSTRCPQCLTAYRIAKP-PKEKSW 78 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 9.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 94 FPYLPYSID*RLFTLETCCGYGYEPARHL 8 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPAC27F1.07 |||dolichyl-diphospho-oligosaccharide-protein glycosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 25.4 bits (53), Expect = 9.3 Identities = 17/63 (26%), Positives = 27/63 (42%) Frame = +2 Query: 254 QNCIYLI*HSRKSSYVSDWIRTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQNW 433 Q +YL S Y +D RTR++ PSA + + ++ R T V S + Sbjct: 133 QYLVYLTTLYLDSPYTTDLQRTRLILPSAKIDTYTTYNIDGAELPNRVGNTLVYESRETI 192 Query: 434 HGQ 442 G+ Sbjct: 193 TGE 195 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,227,403 Number of Sequences: 5004 Number of extensions: 66478 Number of successful extensions: 162 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -