BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0044 (783 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory /... 36 0.030 At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.5 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 2.0 At1g76965.1 68414.m08961 glycine-rich protein 29 2.6 At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family pr... 28 6.1 >At1g01040.1 68414.m00004 DEAD/DEAH box helicase carpel factory / CAF identical to RNA helicase/RNAseIII CAF protein GB:AAF03534 GI:6102610 from [Arabidopsis thaliana] Length = 1909 Score = 35.9 bits (79), Expect = 0.030 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 592 GSQMPRHLISDAHEWINEIPTVPNLLSSETTAKGTGLGESAGKED 726 G +P + +SD + INE+ P +++ E T K GL ++ GK D Sbjct: 70 GGGLPNNGVSDTNSQINEVTVTPQVIAKE-TVKENGLQKNGGKRD 113 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 314 RTRVLRPSADLPSRKVVSVSFRARSARFCTTAVQRSAQN 430 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +3 Query: 297 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 431 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 190 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 95 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g44900.1 68415.m05589 armadillo/beta-catenin repeat family protein / F-box family protein contains similarity to F-box protein FBL2 GI:6010699 from [Rattus norvegicus]; contains Pfam profiles PF00514: Armadillo/beta-catenin-like repeat, PF00646: F-box domain Length = 930 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -3 Query: 166 PSKPDTPRSSEPILI-PKLRIQFADFPYLPYSID*RLFT 53 PS P+T S+E L+ P+L F D+ LPY +LFT Sbjct: 22 PSYPETSISNEEDLVAPELLHGFVDWISLPYDTVLQLFT 60 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,433,506 Number of Sequences: 28952 Number of extensions: 370978 Number of successful extensions: 968 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 941 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 968 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -