BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0038 (545 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 0.88 At3g17920.1 68416.m02282 leucine-rich repeat family protein cont... 29 2.7 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 29 2.7 At3g25420.1 68416.m03161 serine carboxypeptidase S10 family prot... 27 6.2 At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mu... 27 8.2 At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putati... 27 8.2 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 0.88 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +1 Query: 292 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 387 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At3g17920.1 68416.m02282 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 962 Score = 28.7 bits (61), Expect = 2.7 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 110 RLLPSLDVVAVSQAPSPESNPDSPLPVTTMVVAE 211 RLLPSL VV+ +P+ + P S LP + + V E Sbjct: 84 RLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLE 117 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 28.7 bits (61), Expect = 2.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +2 Query: 119 PSLDVVAVSQAPSPESNPDSPLPVTTMVVAETTIES 226 PS A + APSP +NP P T V++ ES Sbjct: 39 PSQSPRATAPAPSPSANPPPSAPTTAPPVSQPPTES 74 >At3g25420.1 68416.m03161 serine carboxypeptidase S10 family protein similar to serine carboxypeptidase I precursor (SP:P37890) from [Oryza sativa] Length = 505 Score = 27.5 bits (58), Expect = 6.2 Identities = 18/63 (28%), Positives = 25/63 (39%) Frame = +1 Query: 187 RDNHGSRRNYHRKLIRQTFERCVPVLDHAICKSYPDSSKLTTSDARPSVDWF*SNKSTHP 366 R + GS YHR L F + DH +C Y S T + VD + S + Sbjct: 401 RHDTGSMIEYHRNLTLSGFRALIFSGDHDMCVPYTGSEAWTKAMGYKVVDEWRPWMSNNQ 460 Query: 367 ITG 375 + G Sbjct: 461 VAG 463 >At3g26780.1 68416.m03350 phosphoglycerate/bisphosphoglycerate mutase family protein similar to X4 protein GI:21386798, Y4 protein GI:21386800 from [Silene dioica]; contains Pfam profiles PF00300: phosphoglycerate mutase family, PF01535: PPR repeat Length = 1053 Score = 27.1 bits (57), Expect = 8.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -2 Query: 334 RRRASRPKSLILMNLDNFCRSHGQVPARIFQMSALSTFDGSFCDYH 197 +R +P S+I +L CR H V ++ L D S C Y+ Sbjct: 842 QRMKMKPDSIIWSSLLAACRIHKNVELAEISVARLFELDSSNCGYY 887 >At1g72560.1 68414.m08391 tRNA export mediator exportin-t, putative (PAUSED) contains Pfam profile: PF04150 exportin-t, identical to PAUSED gi:30909318 Length = 988 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/54 (24%), Positives = 29/54 (53%) Frame = +2 Query: 263 LTMRSAKVIQIHQN*RLRTRGPPSIGFDLIKALIPSLVRVLIACISSRITTVIQ 424 LT + +V++ H+ RL + ++ DL+ ++PS+ V+ C +++Q Sbjct: 304 LTGYAVEVLECHK--RLNSEDTKAVSMDLLNEVLPSVFYVMQKCEVDSTFSIVQ 355 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,088,849 Number of Sequences: 28952 Number of extensions: 254738 Number of successful extensions: 635 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 635 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1023490624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -