BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0034 (626 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC211.07c |ubc8||ubiquitin conjugating enzyme Ubc8|Schizosacch... 27 1.7 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 26 3.9 >SPBC211.07c |ubc8||ubiquitin conjugating enzyme Ubc8|Schizosaccharomyces pombe|chr 2|||Manual Length = 184 Score = 27.5 bits (58), Expect = 1.7 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 189 SGITSFDYYRMTLVDML-MIRIFVVFFPLIC*YPNA 85 SG D T M MI IF VF P + YPNA Sbjct: 81 SGSVCLDVINQTWSPMFDMINIFEVFLPQLLRYPNA 116 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 26.2 bits (55), Expect = 3.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 228 VNYTTRSCARQRTSGITSFDYYRMTLVDMLMI 133 V Y Q G S+ YYR+T VDM ++ Sbjct: 1496 VEYFIMGNPNQNACGEESYWYYRITFVDMTLL 1527 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,418,358 Number of Sequences: 5004 Number of extensions: 47379 Number of successful extensions: 82 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 80 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 82 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 277683324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -