BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0034 (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1357 + 29543922-29545058,29545632-29545784,29545904-29546050 29 3.0 06_01_0734 + 5419951-5420475 29 4.0 07_03_1461 - 26700613-26700621,26700784-26700851,26701778-267019... 28 7.0 04_04_1150 + 31278367-31278885,31280065-31281278,31281759-31283355 28 7.0 >06_03_1357 + 29543922-29545058,29545632-29545784,29545904-29546050 Length = 478 Score = 29.1 bits (62), Expect = 3.0 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 457 WLANTRRAVRFVGSGLALPLALLKSMGDGNHSPSGGPYARL 335 W + R GS LA L LL M PSG YARL Sbjct: 52 WESYDRGIQHHAGSDLASSLRLLADMQAAGLRPSGAAYARL 92 >06_01_0734 + 5419951-5420475 Length = 174 Score = 28.7 bits (61), Expect = 4.0 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -2 Query: 460 LWLANTRRAV---RFVGSGLALPLALLKSMGDGNHSPSG 353 +W A+ A R G GL LA L MGDG SP G Sbjct: 92 VWAASAAAAAADRRGAGGGLMYLLAQLMGMGDGGGSPYG 130 >07_03_1461 - 26700613-26700621,26700784-26700851,26701778-26701919, 26702011-26702318,26702415-26702481,26702543-26702664, 26702763-26702815,26702924-26703006,26703092-26703160, 26703235-26703633 Length = 439 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 5/45 (11%) Frame = +3 Query: 318 FIALVGRRAYGPPDGEWLPSP-----MDFSKARGRARPLPTNLTA 437 FIA + R P G P P D S A+GR++P+P++ +A Sbjct: 326 FIAAMLARPSNPESGPGRPQPRTKQHQDASPAQGRSQPMPSDKSA 370 >04_04_1150 + 31278367-31278885,31280065-31281278,31281759-31283355 Length = 1109 Score = 27.9 bits (59), Expect = 7.0 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 79 VAGIRVLANKWKKDDENSYH*HINQRH 159 + G VL +W+ D H H +QRH Sbjct: 111 IGGTPVLVRRWRPRDHRDQHDHQSQRH 137 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,212,706 Number of Sequences: 37544 Number of extensions: 302762 Number of successful extensions: 606 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 606 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -