BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0034 (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli... 29 3.3 At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein si... 28 5.8 >At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein helicase, putative Length = 2172 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 321 IALVGRRAYGPPDGEWLP-SPMDFSKARGRA-RP 416 + + G + Y P GEW+ SP+D + GRA RP Sbjct: 851 VIIKGTQVYNPERGEWMELSPLDVMQMIGRAGRP 884 >At2g45880.1 68415.m05706 glycosyl hydrolase family 14 protein similar to beta-amylase GI:13560977 from [Castanea crenata] Length = 691 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 436 AVRFVGSGLALPLALLKSMGDGNHSPSGGPYARLPTRA 323 A+R V SGL P+ L G +P+ PY LP ++ Sbjct: 167 ALRVVSSGLRSPVELSSCRMKGVFTPAPSPYDMLPIQS 204 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,317,394 Number of Sequences: 28952 Number of extensions: 241268 Number of successful extensions: 436 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 433 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 436 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -