BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0026 (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.70 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 28 1.6 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 27 2.1 SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosa... 26 5.0 SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 26 5.0 SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharom... 26 5.0 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.6 SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha... 26 6.6 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 8.7 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.70 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -2 Query: 618 ARKIRGRPENAGPDPVRNVRRFSRV 544 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 27.9 bits (59), Expect = 1.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 162 PWNPIEGRYGSEREEHRICGGVRILSADLENQVRDVRGDVAP 287 P+ P+EG Y + ++ HRI R A LE ++R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 27.5 bits (58), Expect = 2.1 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -3 Query: 632 RHDLRLG-RSAEGRRTRVRIQSET*DDFRECHIKYIQFLRPHLLKY*LAKTNITHE 468 + D +LG + A + +V + S+ D +E H+KY+Q + L+ LAK +I E Sbjct: 1053 KEDTKLGEKCANIVQLQVDLLSKLADQEKEKHLKYLQSSYKNSLEVQLAKLDIVKE 1108 >SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosaccharomyces pombe|chr 2|||Manual Length = 352 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -3 Query: 275 STYIPHLIFKVRREYPDTAANAVLFAFRTISPFYRIPWNSNAQA 144 STY P L V D N F I+P+Y WN A A Sbjct: 257 STYWPALAAPVYPSMKDVPNNPFT-PFSPINPYYAKSWNHTASA 299 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 26.2 bits (55), Expect = 5.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +3 Query: 435 SGCXRCRVWSMFVRYVRFSE 494 +GC + VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPCP1E11.08 |||ribosome biogenesis protein Nsa2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 260 Score = 26.2 bits (55), Expect = 5.0 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 623 LRLGRSAEGRRTRVRIQSE-T*DDFRECHIKYIQFLRPHLLKY*LAKTNITHE 468 +R G+S + R+ ++ D F +KY +F+RP L+ K N+TH+ Sbjct: 136 IRTGKSKKNSWKRMITKATFVGDGFTRRPVKYERFIRPMALRQ--KKANVTHK 186 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.6 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 214 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 77 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.8 bits (54), Expect = 6.6 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -2 Query: 696 SSELTVERRSYRIVPIAHETKPTRLTARKIRGRPENAGPDPVRNVRRFS 550 SS+++ E S + +KP+R TA K + + ++ GP+ R + F+ Sbjct: 335 SSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFA 383 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 8.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 360 FPYLHYSID*RLFTLETCCGYGYEPARHL 274 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,182,203 Number of Sequences: 5004 Number of extensions: 67387 Number of successful extensions: 198 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 188 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 198 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -