BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0026 (748 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 30 1.4 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 29 3.3 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.3 At5g42370.1 68418.m05159 expressed protein 29 4.3 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 4.3 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 4.3 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 4.3 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 5.7 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 10.0 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 10.0 At5g22390.1 68418.m02612 expressed protein 27 10.0 At5g16970.1 68418.m01988 NADP-dependent oxidoreductase, putative... 27 10.0 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 456 PGTGXIRFPSKPDTPRSSEPILIPKLRIQFAD 361 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = -3 Query: 587 RVRIQSET*DDFRECHIKYIQFLRPHL 507 R+RIQ DF + + K+++FL PH+ Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPHI 198 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.3 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 243 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 109 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.3 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 182 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 72 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 45 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 176 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 465 STRPGTGXIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 346 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 28.7 bits (61), Expect = 4.3 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 465 STRPGTGXIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 346 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 238 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 140 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.5 bits (58), Expect = 10.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 496 NSLKRT*RTNIDQTRHRXHPLPVQTRHAPVLRANPYSEVTDP 371 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.5 bits (58), Expect = 10.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 496 NSLKRT*RTNIDQTRHRXHPLPVQTRHAPVLRANPYSEVTDP 371 N K T TN T R +P P Q + P + NP ++ T+P Sbjct: 150 NFAKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 10.0 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +3 Query: 117 ERSGKSFLFCLSVRVPWNPIEG 182 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At5g16970.1 68418.m01988 NADP-dependent oxidoreductase, putative (P1) identical to probable NADP-dependent oxidoreductase P1, zeta-crystallin homolog [SP|Q39172][gi:886428], Arabidopsis thaliana; similar to allyl alcohol dehydrogenase [Nicotiana tabacum] GI:6692816; contains Pfam profile PF00107: oxidoreductase, zinc-binding dehydrogenase family Length = 345 Score = 27.5 bits (58), Expect = 10.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 587 RVRIQSET*DDFRECHIKYIQFLRPHL 507 R+RIQ DF + + K+++F+ PH+ Sbjct: 278 RIRIQGFVVSDFYDKYSKFLEFVLPHI 304 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,265,326 Number of Sequences: 28952 Number of extensions: 379893 Number of successful extensions: 1104 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1104 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -