BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0025 (699 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 1.3 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 3.0 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 23 7.0 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 7.0 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 7.0 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.0 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 9.2 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 9.2 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 9.2 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 127 NSSRTSRRRLQATL 86 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 3.0 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 436 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 341 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 23.4 bits (48), Expect = 7.0 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 388 LALRTGACRVWTGSGCDRCRVWSM 459 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 7.0 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -1 Query: 477 TNITHEHRPDPAPVASASRPNPTRPGPQSQSLFRSYGSNLPTSLTYI--ILSTRGSSPWR 304 T + H ++P P S P P P PQ SL R P ++ + S+ GSS Sbjct: 194 TGLHHYYQPSP------SHPQPIVPQPQRASLERRDSLFRPYDISKSPRLCSSNGSSSAT 247 Query: 303 P 301 P Sbjct: 248 P 248 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.4 bits (48), Expect = 7.0 Identities = 19/61 (31%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -1 Query: 477 TNITHEHRPDPAPVASASRPNPTRPGPQSQSLFRSYGSNLPTSLTYI--ILSTRGSSPWR 304 T + H ++P P S P P P PQ SL R P ++ + S+ GSS Sbjct: 194 TGLHHYYQPSP------SHPQPIVPQPQRASLERRDSLFRPYDISKSPRLCSSNGSSSAT 247 Query: 303 P 301 P Sbjct: 248 P 248 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 7.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 675 PLNGGRTESCRSRTKRNR 622 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 9.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 189 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 70 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 9.2 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 189 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 70 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.0 bits (47), Expect = 9.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 456 RPDPAPVASASRPNPTRPGPQSQS 385 +P PA V + PT P PQ Q+ Sbjct: 376 QPVPAVVNPHQQSRPTIPAPQQQT 399 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 792,214 Number of Sequences: 2352 Number of extensions: 17686 Number of successful extensions: 42 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71086350 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -