BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0024 (763 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 1.5 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 25 3.4 Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein... 23 7.8 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 7.8 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 7.8 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 1.5 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 137 NSSRTSRRRLQATL 96 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 398 LALRTGACRVWTGSGCXRCRVWSM 469 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >Y08163-1|CAA69355.1| 192|Anopheles gambiae hypothetical protein protein. Length = 192 Score = 23.4 bits (48), Expect = 7.8 Identities = 12/44 (27%), Positives = 20/44 (45%) Frame = -3 Query: 728 LDSRIPLVRASSELTVERRSYRIVPIAHETKPTRLTARKIRGRP 597 + + + L E V+ I+P A +KPT T + I +P Sbjct: 17 IGASVGLPTVDEENVVQAEQLPILPTADSSKPTDDTVKAIAPQP 60 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 225 VSGYSLRTLKFR*GMYVEMSXRFVPISAAGLQGEE 329 + GYS+RT +FR +++ + + + + GEE Sbjct: 455 IMGYSMRTDRFRYTAWIKFNPDYFKRDWSTIYGEE 489 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 685 PLNGGRTESCRSRTKRNR 632 P +GGR SCRS R R Sbjct: 262 PRSGGRWPSCRSPPARRR 279 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 848,370 Number of Sequences: 2352 Number of extensions: 17753 Number of successful extensions: 39 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -