BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0021 (611 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces ... 25 6.5 SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharo... 25 8.6 SPAC1D4.05c |||Erd1 homolog|Schizosaccharomyces pombe|chr 1|||Ma... 25 8.6 >SPCC663.11 |||ww domain binding protein 11 |Schizosaccharomyces pombe|chr 3|||Manual Length = 278 Score = 25.4 bits (53), Expect = 6.5 Identities = 11/51 (21%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -3 Query: 420 DRCTAPVKLPAWQCPRTGSRGSFKRRRAFPPRHHSAR-LERNTVRPPILST 271 D + LP+ + P + K+ ++F P+HH + + ++ +P +T Sbjct: 148 DESVIDIPLPSEEYPFEDPKPREKKNKSFKPKHHKKQDINASSAQPKSTTT 198 >SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -1 Query: 284 RYY-RPRTASANRVSNETMKVVVFQRRSRETISH 186 RY+ RP +S N + +++ VF+ + T+SH Sbjct: 169 RYFPRPHRSSKNLSVSNRLQLAVFKETTSSTLSH 202 >SPAC1D4.05c |||Erd1 homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -2 Query: 556 TKGSIGRVFAVPMRTEIWIKPAFALLL 476 T+G IG +++ P+ +W+ AF L++ Sbjct: 115 TQGDIGGLYSHPIYPLLWVITAFILIV 141 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,560,242 Number of Sequences: 5004 Number of extensions: 53556 Number of successful extensions: 125 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 125 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -