BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0016 (715 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 28 1.5 SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Sc... 27 3.5 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 26 4.7 SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosa... 26 6.1 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 6.1 SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyce... 26 6.1 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 8.1 SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity prote... 25 8.1 SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha... 25 8.1 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 27.9 bits (59), Expect = 1.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +1 Query: 439 SGCVRCRVWSMFVRYVRFSELVFYIMRPQKLYIF 540 +GC + VW +VR+V F E LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPBC725.11c |php2||CCAAT-binding factor complex subunit Php2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 334 Score = 26.6 bits (56), Expect = 3.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 166 PWNPIEGRYGSEREEHRICGGVRILSADLEIQVRDVRGDVAP 291 P+ P+EG Y + ++ HRI R A LE ++R V+ P Sbjct: 3 PYEPVEGLYVNAKQYHRILKR-REARAKLEERLRGVQTTKKP 43 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 26.2 bits (55), Expect = 4.7 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -3 Query: 623 ARKIRGRPENAGPDPVRNVRR 561 AR I GRPEN G ++N+ R Sbjct: 214 ARTIPGRPENGGNCDIKNLSR 234 >SPBC1289.12 |usp109||U1 snRNP-associated protein Usp109|Schizosaccharomyces pombe|chr 2|||Manual Length = 352 Score = 25.8 bits (54), Expect = 6.1 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -2 Query: 279 STYIPHLNFKVRREYPDTAANAVLFAFRTISPFYRIPWNSNAQA 148 STY P L V D N F I+P+Y WN A A Sbjct: 257 STYWPALAAPVYPSMKDVPNNPFT-PFSPINPYYAKSWNHTASA 299 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.1 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -3 Query: 218 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 81 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPAC30D11.01c ||SPAC56F8.01|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 993 Score = 25.8 bits (54), Expect = 6.1 Identities = 19/81 (23%), Positives = 41/81 (50%), Gaps = 6/81 (7%) Frame = -3 Query: 449 THPLPVQTRHAPVLRANPYSEVTDPICRLPLPTLFYRLEALH-----LGDLLRIWVRTGA 285 +HP ++ R+ P+ N Y+ + + L + L + + +G ++ ++V +G+ Sbjct: 253 SHPFYMEQRYIPIGTTNTYTSASHGVLMLSSNGMEVLLRSTYIKYRMIGGIIDLFVYSGS 312 Query: 284 T-SPRTSLT*ISRSAESIRTP 225 T SP+ + I + +SI TP Sbjct: 313 TVSPKYT---IQQYVQSIGTP 330 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 8.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 364 FPYLHYSID*RLFTLETCCGYGYEPARHL 278 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 >SPBC106.01 |mph1|SPBC1271.16c, SPBC243.01|dual specificity protein kinase Mph1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 678 Score = 25.4 bits (53), Expect = 8.1 Identities = 16/54 (29%), Positives = 24/54 (44%) Frame = -1 Query: 265 SPEFQGPQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRRLQA 104 +P + P VSGH LR+ IS SM +ERS R ++ + + Sbjct: 611 TPLAKKPLPVSGHTNNAHPLRLSTEISASQLSMIIERSVELSKHKRLNKELIDS 664 >SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.4 bits (53), Expect = 8.1 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = -3 Query: 701 SSELTVERRSYRIVPIAHETKPTRLTARKIRGRPENAGPDPVRNVRRF 558 SS+++ E S + +KP+R TA K + + ++ GP+ R + F Sbjct: 335 SSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSF 382 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,112,917 Number of Sequences: 5004 Number of extensions: 67363 Number of successful extensions: 210 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 200 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 210 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -