BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0015 (786 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.76 SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha... 29 0.76 SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni... 27 4.0 SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/F... 27 4.0 SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 26 7.0 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 9.3 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.1 bits (62), Expect = 0.76 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +2 Query: 386 SGCGRCRVWSMFVRYVRFSE 445 +GCG+ VW +VR+V F E Sbjct: 108 NGCGKSYVWPSYVRFVDFDE 127 >SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 29.1 bits (62), Expect = 0.76 Identities = 23/90 (25%), Positives = 41/90 (45%) Frame = -2 Query: 647 SSELTVERRSYRIVPIAHETKPTRLTARKIRGRPENAGPDPVRNVRHFRECHIKYIQFLR 468 SS+++ E S + +KP+R TA K + + ++ GP+ R + F + F + Sbjct: 335 SSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFAGEQPGDLSFQK 394 Query: 467 PHYIKILTR*NEHNARTSTRPGTGRIRFPS 378 I I+ R H+ + R G FP+ Sbjct: 395 GDIIDIVERSGSHDDWWTGRIGYREGIFPA 424 >SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a Pol2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 2199 Score = 26.6 bits (56), Expect = 4.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 581 TRLTARKIRGRPENAGPDPVRNVRHFRECHIKY 483 T L++ + G ENA DP+ +V RE + Y Sbjct: 199 TNLSSENLNGIIENAFEDPLNHVLDIREYDVPY 231 >SPAC1782.09c |clp1|flp1|Cdc14-related protein phosphatase Clp1/Flp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 537 Score = 26.6 bits (56), Expect = 4.0 Identities = 15/40 (37%), Positives = 24/40 (60%) Frame = -2 Query: 248 GTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPNHISL 129 GT++ +IST +P P++VSGH A R+P+ S+ Sbjct: 374 GTSQSNISTPLPEPTPGQPRKVSGHNPP-SARRLPSASSV 412 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 25.8 bits (54), Expect = 7.0 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = -1 Query: 165 MRCSSRSEPYLPSI-GFHGTRTLRQKRKLFPDLSAASSGHFGLPRRT 28 MR + E Y+ + G H T Q LF D + H L RRT Sbjct: 1 MRPAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRT 47 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 9.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 423 TNIDQTRHRPHPLPVQTRHAPV 358 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,278,959 Number of Sequences: 5004 Number of extensions: 69129 Number of successful extensions: 200 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 200 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 381366860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -