BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0015 (786 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 2.6 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 29 3.5 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 29 3.5 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 4.6 At5g42370.1 68418.m05159 expressed protein 29 4.6 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 6.1 At5g44730.2 68418.m05482 haloacid dehalogenase-like hydrolase fa... 28 8.1 At5g44730.1 68418.m05481 haloacid dehalogenase-like hydrolase fa... 28 8.1 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 407 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 312 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 473 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 297 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 473 LRPHYIKILTR*NEHNARTSTRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 297 LRP ++L + ++ ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 352 LRPKMSEVLAKLDQLE---STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 4.6 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 194 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 60 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 133 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 23 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 189 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 91 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At5g44730.2 68418.m05482 haloacid dehalogenase-like hydrolase family protein low similarity to SP|Q94915 Rhythmically expressed gene 2 protein (DREG-2) {Drosophila melanogaster}; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 255 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 282 EALHLGDLLRYGYEPARHLHVH 217 E LH+GD +R Y PA+ + +H Sbjct: 194 EVLHIGDSMRKDYVPAKSIGMH 215 >At5g44730.1 68418.m05481 haloacid dehalogenase-like hydrolase family protein low similarity to SP|Q94915 Rhythmically expressed gene 2 protein (DREG-2) {Drosophila melanogaster}; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 255 Score = 27.9 bits (59), Expect = 8.1 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 282 EALHLGDLLRYGYEPARHLHVH 217 E LH+GD +R Y PA+ + +H Sbjct: 194 EVLHIGDSMRKDYVPAKSIGMH 215 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,769,971 Number of Sequences: 28952 Number of extensions: 387008 Number of successful extensions: 1102 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1061 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -