BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0014 (562 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 >SB_36366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 27.9 bits (59), Expect = 6.0 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 561 HCSKYRNLKLKNMN 520 HCSKYRN+K K +N Sbjct: 264 HCSKYRNIKQKYIN 277 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 27.9 bits (59), Expect = 6.0 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 1/92 (1%) Frame = +2 Query: 284 IVISSISNLGNVTLNFFFITNKSFLINLSNPSLQI-CTIIRDL*EYNNYTRRVTYIVPIS 460 +++S+ L V+ +I S L+ +S L I C + + Y RV+ +V +S Sbjct: 885 LILSAFFFLVFVSRYRLYIVRVSLLVLVSRYRLDIVCVSLVLVSRYRLDIVRVSLLVLVS 944 Query: 461 *QGYLYNTYYFISFLFVY*KFIFFSFKFLYLL 556 +F FL V I F+F FL+LL Sbjct: 945 RYRLDIVRVFFFLFLLVDTVLILFTFLFLFLL 976 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,031,994 Number of Sequences: 59808 Number of extensions: 248668 Number of successful extensions: 493 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1312894764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -