BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0011 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0162 + 1138420-1138640,1138788-1138830,1139449-1140971,114... 32 0.54 02_01_0594 - 4413016-4413091,4413201-4413268,4413387-4413482,441... 29 2.9 03_01_0104 - 830884-831282,831511-832205,832368-833387,833570-83... 29 3.8 04_04_1275 + 32321161-32321285,32321849-32322071,32322187-323223... 29 5.0 06_01_0811 - 6113491-6113925,6114079-6114185,6114569-6114788,611... 28 8.8 >07_01_0162 + 1138420-1138640,1138788-1138830,1139449-1140971, 1141770-1142063,1142145-1142337,1142624-1142694, 1142781-1144200 Length = 1254 Score = 31.9 bits (69), Expect = 0.54 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = -3 Query: 518 HNA*ISFNSLHSV--RSSHSRAIRTKSSSEWVLIG*RPKHWSWS-WSKHEVRRGSWWMI 351 H A + +S H V RS H A + + G RP HW S + RRG WW++ Sbjct: 514 HEA-VDESSAHEVFWRSCHGVAYLCMENVVTEMAGCRPTHWPRSALVRQRRRRGGWWLV 571 >02_01_0594 - 4413016-4413091,4413201-4413268,4413387-4413482, 4413600-4413689,4413760-4413886,4413983-4414038, 4414203-4414379,4414464-4415057 Length = 427 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/55 (25%), Positives = 25/55 (45%) Frame = -3 Query: 401 SWSWSKHEVRRGSWWMIKRSRTLVVRPISPIVISKCIAVFVIPYLSSRKLGGSSV 237 +W S +E S W +R L+ RP+ P+ + +C + L++ G V Sbjct: 137 AWDLSDNEAAPASSWATLPNRALLCRPL-PLDVGRCTCIIAKETLAAAAAGARGV 190 >03_01_0104 - 830884-831282,831511-832205,832368-833387,833570-833696, 834342-834709,834780-835059,835137-835466 Length = 1072 Score = 29.1 bits (62), Expect = 3.8 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = +1 Query: 232 GWTEEPPSFREER*GITNTAMHLEITMGDIGLTTKVLDRL--IIHQDPLRTSCLDQDQDQ 405 GW++ PP E + N A+ LE + + +D L +I D R C+D D Sbjct: 740 GWSDTPPWSLERPGCVLNMAIRLEGNLPVGAMIETTMDHLGVLIEDDAGRNVCID---DL 796 Query: 406 CLGLYPIKTHSEEDLVRMALL 468 P K + LV+ AL+ Sbjct: 797 SSITSPFKENDSFRLVKSALI 817 >04_04_1275 + 32321161-32321285,32321849-32322071,32322187-32322309, 32322391-32322519,32322939-32323024,32323233-32323356, 32323531-32323579,32323808-32323890,32323975-32324042, 32324187-32324264,32324460-32324547,32324640-32324756, 32324844-32325176 Length = 541 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 244 LQSSHNLHSFHILHGCSFCRTE-YS*C*NRYWNVYELFQSIQRYYRFFS 101 L+ H+LH+FH + G E Y +WN + + Q Y F S Sbjct: 250 LELPHSLHAFHRVSGSDSLNMEGYHTYRGGFWNYFSMGMDAQVSYEFHS 298 >06_01_0811 - 6113491-6113925,6114079-6114185,6114569-6114788, 6115112-6115199,6115301-6115431,6115924-6116099, 6116465-6116529,6117014-6117094,6117219-6117358, 6117446-6117532,6117614-6117827,6118102-6118260, 6118860-6118936,6119629-6119796 Length = 715 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -3 Query: 716 NLFLIRSTIIRFRHPFS-QILRMIFLKGNANETFQK 612 +L +I S + R+ P S L +I L GN+ TF+K Sbjct: 427 SLLMICSMVARYAAPISYNFLNLIHLGGNSKTTFEK 462 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,139,499 Number of Sequences: 37544 Number of extensions: 386252 Number of successful extensions: 915 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 883 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 913 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -