BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0011 (733 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M71227-1|AAA36075.1| 120|Homo sapiens immunoglobulin heavy chai... 30 9.8 AK022216-1|BAB13988.1| 538|Homo sapiens protein ( Homo sapiens ... 30 9.8 >M71227-1|AAA36075.1| 120|Homo sapiens immunoglobulin heavy chain VDJC region protein. Length = 120 Score = 29.9 bits (64), Expect = 9.8 Identities = 20/75 (26%), Positives = 29/75 (38%) Frame = +2 Query: 395 TRTNVWAFTQSKPIRKRIWSGWPCYAKT*QSGES*KIFMRCGLTKDSLKNIPREILHKIE 574 + T W + + P R W G Y T + + + R + D+ KN LH + Sbjct: 23 SNTFAWNWIRQSPSRGLEWLGRTFYRSTWYNDYALSVRSRISIDPDTSKNQFSLQLHSVT 82 Query: 575 PEYCGVCALELDSFG 619 PE V DS G Sbjct: 83 PEDTAVYYCARDSVG 97 >AK022216-1|BAB13988.1| 538|Homo sapiens protein ( Homo sapiens cDNA FLJ12154 fis, clone MAMMA1000468. ). Length = 538 Score = 29.9 bits (64), Expect = 9.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 190 KMNSREEYEMNEDCGWTEEPPSFREER*GITNTAMHLE 303 ++ S EE +NE W PP FR +R +T HL+ Sbjct: 425 ELMSDEEDSLNEPSVWVARPPRFRAQR--LTELCYHLD 460 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,331,180 Number of Sequences: 237096 Number of extensions: 2212435 Number of successful extensions: 4822 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4687 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4821 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -