BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0009 (535 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 26 0.91 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 25 2.1 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 24 2.8 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 24 3.7 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 6.4 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 23 6.4 AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ chann... 23 6.4 AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium ch... 23 6.4 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 8.5 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 8.5 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 8.5 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 8.5 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 25.8 bits (54), Expect = 0.91 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -3 Query: 137 NSSRTSRRRLQATL 96 NSSRT+ RRLQATL Sbjct: 350 NSSRTAIRRLQATL 363 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 24.6 bits (51), Expect = 2.1 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -3 Query: 446 RIRFPSKPDTPRSSEPILIPKLRIQFADFPYL 351 R+R + TP+ +++PKL+ + A P+L Sbjct: 5 RLRLITSFGTPQDKRTMVLPKLKDETAVMPFL 36 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 24.2 bits (50), Expect = 2.8 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -2 Query: 120 SAASSGHFGLPRRTLVFKDEGTIIETVPITGSGIGKGFPF 1 S+ + F +P T F D T I +P G+G G GFPF Sbjct: 76 SSGAFPQFSIPSWTN-FTDAFTSI--LPFFGNGQGGGFPF 112 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 23.8 bits (49), Expect = 3.7 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +2 Query: 398 LALRTGACRVWTGSGCVRCRVWSM 469 +++ G V G+ C C VWSM Sbjct: 5 ISVHVGQAGVQIGNPCWDCTVWSM 28 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 23.0 bits (47), Expect = 6.4 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 225 VSGYSLRTLKFR*GMYVEMSRRFVPISAAGLQGEE 329 + GYS+RT +FR +++ + + + + GEE Sbjct: 455 IMGYSMRTDRFRYTAWIKFNPDYFKRDWSTIYGEE 489 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.0 bits (47), Expect = 6.4 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = -3 Query: 296 YEPARHLHVHPSPEFQGPQRVSGHRRKCGA 207 ++ H H + GP +S R CGA Sbjct: 655 HQGQHHAQHHSNGTHHGPSLMSSARESCGA 684 >AJ441131-5|CAD29634.1| 574|Anopheles gambiae putative Na+ channel protein. Length = 574 Score = 23.0 bits (47), Expect = 6.4 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 199 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 80 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >AJ439398-4|CAD28127.1| 572|Anopheles gambiae putative sodium channel protein. Length = 572 Score = 23.0 bits (47), Expect = 6.4 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = -1 Query: 199 FRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSN 80 F T+ Y N+ A + T G G FRP+ TP N Sbjct: 213 FNTLDTVYMFR-NATAPSIFPTEVGSSSGRFRPILWTPEN 251 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 175 RIPWNSNAQAEKKTLPGPLG 116 +IPW+ NA+A K G G Sbjct: 317 QIPWDRNAEALAKWASGQTG 336 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.5 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = -2 Query: 414 PVLRANPYSEVTDPICRLPXPTLFYR 337 P L S + P CRLP P L R Sbjct: 89 PELVTRSLSNLELPSCRLPCPNLIPR 114 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 8.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 99 FGLPRRTLVFKDEGTI 52 FG+P++ + KD GT+ Sbjct: 1660 FGMPKQIVELKDTGTV 1675 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 8.5 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 99 FGLPRRTLVFKDEGTI 52 FG+P++ + KD GT+ Sbjct: 1661 FGMPKQIVELKDTGTV 1676 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 22.6 bits (46), Expect = 8.5 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +1 Query: 376 IRNFGIRIGSEDRGVSGLDGKRMRPVPG 459 I N I R VSGLD R P PG Sbjct: 10 IGNLFIEPNRYRRIVSGLDSTRGSPAPG 37 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 609,377 Number of Sequences: 2352 Number of extensions: 13021 Number of successful extensions: 39 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -