BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0007 (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|c... 29 0.39 SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe... 29 0.52 SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1 |Schiz... 26 3.6 SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccha... 26 4.8 SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharom... 25 6.3 SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyce... 25 6.3 >SPAC824.02 |||GPI inositol deacylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 1142 Score = 29.5 bits (63), Expect = 0.39 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +2 Query: 203 SGCGRCRVWSMFVRYVRLAS*YFNIMRPQKLYIF 304 +GCG+ VW +VR+V Y LY++ Sbjct: 108 NGCGKSYVWPSYVRFVDFDERYTRFANKYSLYLY 141 >SPAC869.04 |||formamidase-like protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 29.1 bits (62), Expect = 0.52 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -3 Query: 386 ARKIRGRPENAGPDPVRNVRRFSRV 312 AR I GRPEN G ++N+ R S+V Sbjct: 214 ARTIPGRPENGGNCDIKNLSRGSKV 238 >SPAC821.11 |pro1||gamma-glutamyl phosphate reductase Pro1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 451 Score = 26.2 bits (55), Expect = 3.6 Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 3/28 (10%) Frame = +2 Query: 461 NWHGQGESDCLIKTKHAMA---LAGVDA 535 N HG +DC+I + A A +AG+DA Sbjct: 341 NTHGSKHTDCIITSSEAAANRFMAGIDA 368 >SPAPJ696.02 |||actin cortical patch component Lsb4 |Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.8 bits (54), Expect = 4.8 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -3 Query: 464 SSELTVERRSYRIVPIAHETKPTRLTARKIRGRPENAGPDPVRNVRRFS 318 SS+++ E S + +KP+R TA K + + ++ GP+ R + F+ Sbjct: 335 SSDVSTESSSQFSSRSSEYSKPSRPTAPKPKFKQDSLGPNQARAMYSFA 383 >SPCC1393.04 |fta4|sma6|Sim4 and Mal2 associated |Schizosaccharomyces pombe|chr 3|||Manual Length = 233 Score = 25.4 bits (53), Expect = 6.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 240 TNIDQTRHRPHPLPVQTRHAPV 175 +N+D + PHP P Q PV Sbjct: 100 SNLDSVKSLPHPWPFQKESRPV 121 >SPCC11E10.03 |mug1||dynactin complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 351 Score = 25.4 bits (53), Expect = 6.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -3 Query: 128 FPYLHYSID*RLFTLETCCGYGYEPARHL 42 +P+ S+D R+F LE+ GY EP L Sbjct: 159 YPFDLDSLDKRIFKLESKIGYADEPLSEL 187 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,477,020 Number of Sequences: 5004 Number of extensions: 50190 Number of successful extensions: 123 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -