BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0007 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 26 0.32 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 26 0.32 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 26 0.32 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 26 0.32 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 26 0.32 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 26 0.32 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 24 0.98 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 2.3 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 2.3 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 2.3 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 2.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.3 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 6.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.2 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.32 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.32 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.32 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 25.8 bits (54), Expect = 0.32 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 25.8 bits (54), Expect = 0.32 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 25.8 bits (54), Expect = 0.32 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + +RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDRNSYRNDGERSCSRDRS 258 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 24.2 bits (50), Expect = 0.98 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + RH+ R +G R+ R +S Sbjct: 226 RTSSCHSRYEDLRHEDRNSYRNDGERSCSRDRS 258 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 436 RTESCRSRTKRNRHDLRLGRSAEGRRTRVRIQS 338 RT SC SR + +RH+ +G R+ R +S Sbjct: 226 RTSSCHSRYEDSRHEDGNSYRNDGERSCSRDRS 258 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 425 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 324 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 425 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 324 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 2.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -3 Query: 425 VPIAHETKPTRLTARKIRGRPENAGPDPVRNVRR 324 VPI TKP AR +G N G + V V++ Sbjct: 292 VPIDANTKPCTWAARPWQGYMTNNGVNNVEAVQK 325 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -3 Query: 266 TNSLNEHNARTSTRPGTGRIRFPSKPDTPRSS 171 T+++ A T+ RPGT + KP P +S Sbjct: 1103 TSTVTAAAAATNIRPGTADNKPQLKPQKPFTS 1134 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 449 VERRSYRIVPIAHETKPTRLTARKIRGRPEN 357 VE + Y+ V I+ T+P+ T + P N Sbjct: 183 VEEQRYKQVEISQMTEPSSSTKSYVLEGPRN 213 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = -2 Query: 213 PHPLPVQTRHAPVLRANPYSEV 148 P PLP A + + +PYS + Sbjct: 652 PFPLPPNLASANISQLDPYSSL 673 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,319 Number of Sequences: 438 Number of extensions: 3902 Number of successful extensions: 14 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -