BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0007 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g76965.1 68414.m08961 glycine-rich protein 29 1.8 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 4.1 At2g02800.2 68415.m00225 protein kinase (APK2b) identical to pro... 28 5.4 At2g02800.1 68415.m00224 protein kinase (APK2b) identical to pro... 28 5.4 At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-conta... 27 7.2 At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-conta... 27 7.2 >At1g76965.1 68414.m08961 glycine-rich protein Length = 158 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 224 PGTGRIRFPSKPDTPRSSEPILIPKLRIQFAD 129 PG + FP KP+ P P +P+L + F D Sbjct: 93 PGAAIVVFPKKPEEPVKVVPTPMPQLNLFFGD 124 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 355 RVRIQSET*DDFRECHIKYIQFLRPH 278 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At2g02800.2 68415.m00225 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 233 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 114 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At2g02800.1 68415.m00224 protein kinase (APK2b) identical to protein kinase APK2b [Arabidopsis thaliana] gi|2852449|dbj|BAA24695 Length = 426 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/41 (36%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -3 Query: 233 STRPGTGRIRFPSKPDTPRSSEPILIPKLRIQFA-DFPYLH 114 ST+PGTG ++ D+PR S ++ K +++ D P LH Sbjct: 368 STKPGTGVGNRQAQIDSPRGSNGSIVQKSPRRYSYDRPLLH 408 >At5g37380.2 68418.m04492 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 258 AKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 139 AK T TN T R +P P Q + P + NP ++ T+P Sbjct: 152 AKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 >At5g37380.1 68418.m04491 DNAJ heat shock N-terminal domain-containing protein similar to SP|Q9QYI4 DnaJ homolog subfamily B member 12 {Mus musculus}; contains Pfam profile PF00226: DnaJ domain Length = 431 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 258 AKRT*RTNIDQTRHRPHPLPVQTRHAPVLRANPYSEVTDP 139 AK T TN T R +P P Q + P + NP ++ T+P Sbjct: 152 AKTTFTTNARTTTPRNNP-PAQKTNPPAQKTNPPAQKTNP 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,352,004 Number of Sequences: 28952 Number of extensions: 279493 Number of successful extensions: 803 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 803 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -