BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0003 (768 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901,938... 30 2.3 03_03_0090 + 14367033-14367279,14367402-14368205,14368314-143700... 28 7.1 03_03_0053 + 14109636-14109948,14110075-14110302,14112030-141121... 28 7.1 12_01_0673 - 5745956-5750346,5750788-5750872,5751018-5751082,575... 28 9.4 >10_06_0002 + 9382559-9382937,9383008-9383180,9386752-9386901, 9387180-9387325,9387416-9387572,9387720-9387778, 9388204-9388360,9389001-9389150,9389280-9389416, 9390071-9390217,9390292-9390393,9390742-9390799, 9391997-9392034,9392124-9392250,9392320-9392493, 9393125-9393256,9393940-9394049,9394752-9394812, 9395036-9395213,9395326-9395531,9395796-9395915, 9396496-9396594,9396983-9397204,9397482-9397621, 9397741-9397852,9398021-9398071,9398151-9398240, 9398397-9398567,9398663-9398815,9399774-9399950, 9400045-9400182,9400295-9400365,9400739-9400838, 9401324-9401380,9401469-9401525,9401619-9401699, 9401782-9401864,9401975-9402110 Length = 1632 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +2 Query: 302 CRPTSTLTEEHRDRILILNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYELFNRNN 481 C + + D+ L+L R+ + MLR +TA+A +++ K E ++NN Sbjct: 1045 CAAAKSAAQSEHDKNLLLQRQLDDSLREITMLRSSKIMTAEAERENSNLKNLVESLSKNN 1104 Query: 482 FSIRY 496 S+ Y Sbjct: 1105 SSLEY 1109 >03_03_0090 + 14367033-14367279,14367402-14368205,14368314-14370039, 14370135-14370219,14370398-14370457,14370744-14370836 Length = 1004 Score = 28.3 bits (60), Expect = 7.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 172 INHYLGVLKTNKIEPRSYSIIPCTKYSRAFLARFE 276 I H L +LK KI P +I C +YS ++ F+ Sbjct: 819 ILHALHILKAEKIFPTESNIADCIRYSEMNISGFD 853 >03_03_0053 + 14109636-14109948,14110075-14110302,14112030-14112181, 14112305-14112578,14112687-14112739 Length = 339 Score = 28.3 bits (60), Expect = 7.1 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 160 PVIPINHYLGVLKTNKIEPRSYSIIPCTKYSRAFLARFEHS 282 P+ + YLG+ NK+ P+ Y + C K+ F H+ Sbjct: 248 PIGCVPGYLGIFP-NKLSPKDYDVFGCIKWLNDFSKYHNHA 287 >12_01_0673 - 5745956-5750346,5750788-5750872,5751018-5751082, 5751816-5751993 Length = 1572 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 609 VIFRHYLPVPGVGNLRAAGFLGCGKPFLRLPLRNRTLIPV 728 ++ +H P + NLR G+ GC PF L R L+ + Sbjct: 926 LVLQHLEPHTNIRNLRICGYEGCVVPFWIENLSVRKLVSI 965 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,878,399 Number of Sequences: 37544 Number of extensions: 449238 Number of successful extensions: 1148 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1148 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -