BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0003 (768 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. 26 1.5 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 25 2.6 >AY578808-1|AAT07313.1| 458|Anopheles gambiae saxophone protein. Length = 458 Score = 25.8 bits (54), Expect = 1.5 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = -2 Query: 722 NQGSIPERKPEKRLTTSKEASSAQITHSRHGEVVTKNNDTGL 597 N GS PE P + T SK+ S + HS VT + +GL Sbjct: 103 NNGSFPELPPMRGKTYSKKLSFEYLQHS-----VTSGSGSGL 139 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 25.0 bits (52), Expect = 2.6 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = +2 Query: 353 LNRRFLERRLTDDMLRKRVSITADACTDSAAHKCNYELFNR 475 +++ + + ++L +I +D DS+ CN E FN+ Sbjct: 620 ISKELTKASIIQEILNIPTTIASDVAFDSSDFPCNSEEFNK 660 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 793,130 Number of Sequences: 2352 Number of extensions: 16063 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -