BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0002 (406 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC607.05 |rpn9||19S proteasome regulatory subunit Rpn9|Schizos... 53 1e-08 SPAC1751.03 ||SPAC31A2.01|translation initiation factor eIF3m|Sc... 26 2.6 >SPAC607.05 |rpn9||19S proteasome regulatory subunit Rpn9|Schizosaccharomyces pombe|chr 1|||Manual Length = 381 Score = 53.2 bits (122), Expect = 1e-08 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -3 Query: 404 KIAILCLMEMAFNKSSSQRKLSFEEIAREARIPLDEVELLIMKALAEKLIEDI 246 KI ++ L+E+ F +QR L+F+ IAR RIP +EVELLIM+AL+ LI + Sbjct: 276 KIRLMALIELVFQLPPNQRTLTFDTIARATRIPSNEVELLIMRALSVGLITGV 328 >SPAC1751.03 ||SPAC31A2.01|translation initiation factor eIF3m|Schizosaccharomyces pombe|chr 1|||Manual Length = 402 Score = 25.8 bits (54), Expect = 2.6 Identities = 14/51 (27%), Positives = 28/51 (54%) Frame = -3 Query: 404 KIAILCLMEMAFNKSSSQRKLSFEEIAREARIPLDEVELLIMKALAEKLIE 252 K+ +L + +A + LS+ ++A+ +I +EVEL I+ + L+E Sbjct: 282 KMKLLTIASLA--TQAPNNTLSYGDVAKSLKIDENEVELWIIDVIRAGLVE 330 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,212,322 Number of Sequences: 5004 Number of extensions: 17211 Number of successful extensions: 44 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 138190552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -