BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVm0002 (406 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49130-6|CAA88971.1| 387|Caenorhabditis elegans Hypothetical pr... 55 2e-08 AC024211-6|AAF36067.2| 1454|Caenorhabditis elegans Hypothetical ... 34 0.045 >Z49130-6|CAA88971.1| 387|Caenorhabditis elegans Hypothetical protein T06D8.8 protein. Length = 387 Score = 54.8 bits (126), Expect = 2e-08 Identities = 24/50 (48%), Positives = 38/50 (76%) Frame = -3 Query: 404 KIAILCLMEMAFNKSSSQRKLSFEEIAREARIPLDEVELLIMKALAEKLI 255 KI ++ +ME+A ++ + R +SF+EIA + +IP DEVE L+MKAL++ LI Sbjct: 280 KIRLMAVMELAVSRPTKARSVSFKEIATKCQIPFDEVEFLVMKALSKDLI 329 >AC024211-6|AAF36067.2| 1454|Caenorhabditis elegans Hypothetical protein Y76B12C.7 protein. Length = 1454 Score = 33.9 bits (74), Expect = 0.045 Identities = 16/47 (34%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = -3 Query: 386 LMEMAFNKSSSQRKLSFEEIAREARIPLDEVELL--IMKALAEKLIE 252 L+++ + +RK ++ A+EA +P DE E L MK L E+++E Sbjct: 809 LVDLTVEEEEKERKAKAQQAAKEASVPTDEAEQLNTEMKQLCERVLE 855 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,881,716 Number of Sequences: 27780 Number of extensions: 103998 Number of successful extensions: 194 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 194 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 641068680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -