BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1136 (514 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17045| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_8042| Best HMM Match : DUF803 (HMM E-Value=0) 30 0.97 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) 30 1.3 SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) 30 1.3 SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 30 1.3 SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) 30 1.3 SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 30 1.3 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 30 1.3 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 30 1.3 SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) 29 2.2 SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.9 SB_55282| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.2 SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 27 6.9 SB_16103| Best HMM Match : RVP (HMM E-Value=0.027) 27 6.9 SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 >SB_17045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 30.7 bits (66), Expect = 0.74 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 253 GVVVLNLLFTKVHAVAGVEFKVLEECCQFIDFNIS 357 GV LNL++ KVH +A F CC F+ F +S Sbjct: 268 GVKELNLIYMKVH-IAYSTFSAFYVCCGFLSFVLS 301 >SB_8042| Best HMM Match : DUF803 (HMM E-Value=0) Length = 603 Score = 30.3 bits (65), Expect = 0.97 Identities = 19/83 (22%), Positives = 41/83 (49%), Gaps = 2/83 (2%) Frame = -2 Query: 513 HFMPSAMDFYQTSLRDPAFYQLYN--RIVEYIVEFKQYLKPYTQDKLYFDGVKITDVKVD 340 +++ A+D + TSL P +Y ++ I+ + FK++ T+D + +T + Sbjct: 477 NYLNKALDIFNTSLVTPIYYVMFTLLTIIASAILFKEWKLMDTKDTIGSICGVLTIILGV 536 Query: 339 KLTTFFENFEFDASNSVYFSKEE 271 L F+N +F + +F K++ Sbjct: 537 FLLHAFKNVKFSLKDLNFFQKQK 559 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 219 SWLRLFKLDWPSMKLVEGKNTALSDLTE 246 >SB_36107| Best HMM Match : zf-CCHC (HMM E-Value=0.00023) Length = 425 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 377 SWLRLFKLDWPSIKLVQGKNTALSDLTE 404 >SB_24180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 293 SWLRLFKLDWPSIKLVQGKNTALSDLTE 320 >SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) Length = 877 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 76 SWLRLFKLDWPSIKLVQGKNTALSDLTE 103 >SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 797 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 287 SWLRLFKLDWPSIKLVQGKNTALSDLTE 314 >SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) Length = 522 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 164 SWLRLFKLDWPSIKLVQGKNTALSDLTE 191 >SB_32803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 15 SWLRLFKLDWPSIKLVQGKNTALSDLTE 42 >SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1122 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 399 SWLRLFKLDWPSIKLVQGKNTALSDLTE 426 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 467 SWLRLFKLDWPSIKLVQGKNTALSDLTE 494 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 1117 SWLRLFKLDWPSIKLVQGKNTALSDLTE 1144 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 143 SWLRLFKLDWPSMKLVEGKNTALSDLTE 170 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 29.9 bits (64), Expect = 1.3 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 176 SWLRLFKLDWPSIKLVQGKNTALSDLTE 203 >SB_20046| Best HMM Match : UPAR_LY6 (HMM E-Value=3.2) Length = 419 Score = 29.1 bits (62), Expect = 2.2 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL G+N + + E Sbjct: 349 SWLRLFKLDWPSIKLVQGKNIALSDLTE 376 >SB_49488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1228 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+L+W + KL G+N + + E Sbjct: 344 SWLRLFKLEWPSIKLVQGKNTALSDLTE 371 Score = 28.3 bits (60), Expect = 3.9 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+L+W + KL G+N + + E Sbjct: 827 SWLRLFKLEWPSIKLVQGKNTALSDLTE 854 >SB_55282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1565 Score = 27.9 bits (59), Expect = 5.2 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -2 Query: 255 AMTLRCASHD*TTAPSTLTLR 193 A + R A H+ TTAPSTLT+R Sbjct: 383 APSTRQADHNLTTAPSTLTMR 403 >SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1084 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL +N + + E Sbjct: 365 SWLRLFKLDWPSIKLVQSKNTALSDLTE 392 >SB_16103| Best HMM Match : RVP (HMM E-Value=0.027) Length = 274 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -1 Query: 103 NWMKFFELDWFTTKLTAGQNKIIRNSNE 20 +W++ F+LDW + KL +N + + E Sbjct: 135 SWLRLFKLDWPSIKLVQSKNTALSDLTE 162 >SB_14296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 222 TTAPSTLTLRLILMSP-VTLLSKSSWLPNTMTTEYLS 115 TTAP T T L+ +P T S ++ P T T +L+ Sbjct: 61 TTAPETTTASLVTTAPETTTASLATTAPETTTASFLT 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,262,741 Number of Sequences: 59808 Number of extensions: 261920 Number of successful extensions: 698 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 628 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 698 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1136110413 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -