BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1128 (596 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8A5N4 Cluster: Putative uncharacterized protein; n=1; ... 34 2.9 UniRef50_Q11VU8 Cluster: Putative uncharacterized protein; n=1; ... 33 6.7 >UniRef50_Q8A5N4 Cluster: Putative uncharacterized protein; n=1; Bacteroides thetaiotaomicron|Rep: Putative uncharacterized protein - Bacteroides thetaiotaomicron Length = 857 Score = 33.9 bits (74), Expect = 2.9 Identities = 14/37 (37%), Positives = 24/37 (64%) Frame = -2 Query: 148 SLQLYQTGELPAYTVSKFKFDTERSVRSFVEYFYMYM 38 SLQ++Q GE+P +T F+ E S+R F + Y+++ Sbjct: 38 SLQIFQEGEIPCFT-KNFQLSFELSIRDFDTFGYVFL 73 >UniRef50_Q11VU8 Cluster: Putative uncharacterized protein; n=1; Cytophaga hutchinsonii ATCC 33406|Rep: Putative uncharacterized protein - Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) Length = 1807 Score = 32.7 bits (71), Expect = 6.7 Identities = 16/42 (38%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = -2 Query: 157 FLLSLQLYQTGELPAY-TVSKFKFDTERSVRSFVEYFYMYMR 35 +LL+ +TG+ +Y T+S FD E+S+ SF +Y Y+R Sbjct: 1506 YLLASTYLRTGDQGSYRTLSPKSFDNEKSINSFGGSYYSYVR 1547 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,927,236 Number of Sequences: 1657284 Number of extensions: 10179198 Number of successful extensions: 21978 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 21422 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21976 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -