BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1128 (596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 25 0.48 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 6.0 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 21 6.0 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 21 7.9 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 21 7.9 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 25.0 bits (52), Expect = 0.48 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 351 RMSRSKFKPDLKTRTGTSHSSILAQWTTTNS 443 R S + KP L TG++ S +A T TNS Sbjct: 183 RDSPNYIKPQLHVSTGSTSSPTIASATYTNS 213 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.4 bits (43), Expect = 6.0 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 537 VLLILYSVFYNSSRKTLFFVTVPLKIVN*ARMSLLSSIV 421 VLL+++ V + T+FF T ++ MSLL+ I+ Sbjct: 526 VLLLMFGVSFVVIVITIFFFTANVQAGELYFMSLLNPIL 564 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 21.4 bits (43), Expect = 6.0 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 537 VLLILYSVFYNSSRKTLFFVTVPLKIVN*ARMSLLSSIV 421 VLL+++ V + T+FF T ++ MSLL+ I+ Sbjct: 251 VLLLMFGVSFVVIVITIFFFTANVQAGELYFMSLLNPIL 289 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -1 Query: 71 SFFCRIFLYVYENGRFVPCRL 9 S +CR+F + E F P R+ Sbjct: 279 SEYCRVFKMLQEEDIFTPDRI 299 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 21.0 bits (42), Expect = 7.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +3 Query: 339 PDSWRMSRSKFKPD 380 PD W+ +K+ PD Sbjct: 100 PDYWKALEAKYDPD 113 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,632 Number of Sequences: 336 Number of extensions: 2839 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -