BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1120 (551 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1680 - 39123536-39123628,39123726-39123821,39123941-391240... 31 0.61 03_03_0040 - 13999040-13999179,13999524-13999638,13999759-139998... 29 1.9 10_08_0100 + 14788426-14789097 29 3.3 02_05_0169 - 26428330-26429367,26429489-26429640,26429757-26430333 29 3.3 01_05_0297 - 20578031-20578080,20578162-20578236,20578317-205784... 28 4.3 >01_06_1680 - 39123536-39123628,39123726-39123821,39123941-39124093, 39124273-39124382,39124601-39124757,39124867-39124877, 39125138-39125228,39125401-39125496,39125605-39125724, 39125914-39125978,39126066-39126168,39126406-39126631, 39126714-39126790 Length = 465 Score = 31.1 bits (67), Expect = 0.61 Identities = 22/68 (32%), Positives = 32/68 (47%) Frame = +3 Query: 303 SIEGVLLAKIPHDWADYEPDNAGGDENCILMYPDGSFADVNCTDTFQYVCYKKKTSTVAM 482 SI G L P D+ D EPD + I+ + D C + +C++KK TV Sbjct: 347 SIYGKQLMIDPQDFQDAEPDILANSASEIINRIKEN--DDQCAMALRSLCHRKKGLTVEE 404 Query: 483 SSCGSVDS 506 +S S+DS Sbjct: 405 ASLISIDS 412 >03_03_0040 - 13999040-13999179,13999524-13999638,13999759-13999818, 14000007-14000060,14000274-14000333,14000418-14000480, 14000552-14000595,14000671-14000755,14000904-14001028, 14001368-14001432,14001460-14001518,14001678-14001743, 14001870-14001935,14002019-14002105,14002168-14002257, 14002378-14002440,14003153-14003419 Length = 502 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/23 (52%), Positives = 18/23 (78%) Frame = +3 Query: 132 SSYLARGSIKMSFGRICIGFTSG 200 S +LA+G I + FGRI +GF++G Sbjct: 164 SLHLAKGVIMLYFGRILLGFSTG 186 >10_08_0100 + 14788426-14789097 Length = 223 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 357 PDNAGGDENCILMYPDGSFADVNCTDTFQY 446 P AGG E C+ YP+G A D Q+ Sbjct: 53 PFTAGGHEWCVDFYPNGKLAAAGDADMIQF 82 >02_05_0169 - 26428330-26429367,26429489-26429640,26429757-26430333 Length = 588 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%) Frame = +1 Query: 52 CSVVGQQFRYDYTYFRNINGWLK--LQEIPAI 141 C+ +G ++ Y ++GWLK LQE PA+ Sbjct: 371 CAALGHLAKHQRDYVHALHGWLKLTLQEAPAV 402 >01_05_0297 - 20578031-20578080,20578162-20578236,20578317-20578416, 20578476-20578535,20578833-20578907,20578989-20579069, 20579596-20579665,20579769-20579833,20580008-20580116, 20580812-20580876,20580964-20581023,20582008-20582134, 20582215-20582315,20583209-20583316,20583429-20583464, 20583569-20583714,20585555-20585564 Length = 445 Score = 28.3 bits (60), Expect = 4.3 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = +1 Query: 157 LRCHLEGSVLASPLDAALKSSMLSLITNKKSSWASTLVFMRYSREETSVQLKEFYWQK 330 L+CH+ V + L LK + S + S T + Y+RE +VQ F+W++ Sbjct: 237 LKCHISHDV--NHLHEGLKHGLKSELEKASPSLGRTAL---YTREYLTVQFVRFFWKR 289 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,195,105 Number of Sequences: 37544 Number of extensions: 285957 Number of successful extensions: 645 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 645 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1245816180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -