BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1110 (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_53162| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_24294| Best HMM Match : RVT_2 (HMM E-Value=0) 55 4e-08 SB_30586| Best HMM Match : RVT_2 (HMM E-Value=0.4) 53 2e-07 SB_45012| Best HMM Match : RVT_2 (HMM E-Value=1.2e-17) 35 0.048 SB_28383| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_20137| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.1 SB_21157| Best HMM Match : Laminin_EGF (HMM E-Value=0.036) 28 5.5 SB_41336| Best HMM Match : Laminin_EGF (HMM E-Value=0.036) 28 5.5 SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 SB_25313| Best HMM Match : REJ (HMM E-Value=0.012) 28 7.2 SB_14489| Best HMM Match : DUF789 (HMM E-Value=5.6) 28 7.2 SB_806| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_48624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 813 Score = 69.7 bits (163), Expect = 2e-12 Identities = 37/88 (42%), Positives = 54/88 (61%), Gaps = 3/88 (3%) Frame = +2 Query: 2 LYGDIQEDVYMRLPPGC---DDNVSVVKLNKSIYGLKKSPKYWNLKFDKVIAKKGFSRSE 172 L G++QE+VYM+ P G V KLN+SIYGLK+SP+ WN D + K GF+++ Sbjct: 607 LNGELQEEVYMKHPEGFVVKGKEHLVCKLNRSIYGLKQSPRCWNAVLDDKLKKMGFAQTT 666 Query: 173 NDFCLYCKVNCEYKIYLLLFVDDILIMG 256 D C+Y + E I + ++V DIL+ G Sbjct: 667 GDPCIYTALEGEMFI-IAVYVADILLAG 693 Score = 50.4 bits (115), Expect = 1e-06 Identities = 25/85 (29%), Positives = 49/85 (57%) Frame = +1 Query: 253 GTNDKVVHNLKLYLSNIFSMKDLGHVTNYLGIHVEQDLQNGIIKMSQNHYLRQILKKFNM 432 G + K + +K L F +KD+G + ++LG+ V Q + G + + Q+ Y + +L++F M Sbjct: 693 GKSGKRMTEVKQALPKQFKIKDMGELHHFLGVKVIQKPETGELWIGQSTYGKGVLERFGM 752 Query: 433 CESKPMSTPMEFKFQMFQSNNSDPK 507 SK +STP++ ++ ++ N K Sbjct: 753 ENSKAISTPVDASTKLVKATNDYEK 777 >SB_53162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 962 Score = 62.1 bits (144), Expect = 4e-10 Identities = 31/88 (35%), Positives = 55/88 (62%), Gaps = 5/88 (5%) Frame = +2 Query: 2 LYGDIQEDVYMRLPPGCD---DNVS--VVKLNKSIYGLKKSPKYWNLKFDKVIAKKGFSR 166 L+ I +++YM+ P G + +N V KL KS+YGLK+S + WN + + + GF+R Sbjct: 630 LHAPIDQEIYMKQPEGFEVISENGEKLVYKLKKSLYGLKQSGRNWNKLLHESLMESGFNR 689 Query: 167 SENDFCLYCKVNCEYKIYLLLFVDDILI 250 + +D C+Y K+ + L+++VDD++I Sbjct: 690 NPSDPCVYSKLVGNEIVILIVWVDDLII 717 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/66 (37%), Positives = 39/66 (59%) Frame = +1 Query: 268 VVHNLKLYLSNIFSMKDLGHVTNYLGIHVEQDLQNGIIKMSQNHYLRQILKKFNMCESKP 447 ++++ K + F MKDLG ++++LGI Q G I M Q+ YL ++L +F M KP Sbjct: 724 ILNDFKENMKRHFKMKDLGQISHFLGIDFNQ--APGQITMGQSRYLLKVLHRFEMEGCKP 781 Query: 448 MSTPME 465 +TP E Sbjct: 782 RTTPCE 787 Score = 35.1 bits (77), Expect = 0.048 Identities = 13/20 (65%), Positives = 19/20 (95%) Frame = +3 Query: 516 KCRQILGSLMYAVLCTRPDL 575 K R+I+GSL+YA++CTRPD+ Sbjct: 801 KYREIVGSLIYAMVCTRPDI 820 >SB_59345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1031 Score = 56.0 bits (129), Expect = 2e-08 Identities = 29/88 (32%), Positives = 54/88 (61%), Gaps = 5/88 (5%) Frame = +2 Query: 2 LYGDIQEDVYMRLPPGCD---DNVS--VVKLNKSIYGLKKSPKYWNLKFDKVIAKKGFSR 166 L+ I +++YM+ P G + +N V KL KS+YGLK+S + N + + + GF+R Sbjct: 754 LHAPIDQEIYMKQPEGFEVIFENGEKLVYKLKKSLYGLKESGRNCNKLLHESLMESGFNR 813 Query: 167 SENDFCLYCKVNCEYKIYLLLFVDDILI 250 + +D C+Y K+ + L+++V+D++I Sbjct: 814 NPSDHCVYSKLVGNEIVILIVWVNDLII 841 Score = 28.7 bits (61), Expect = 4.1 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +1 Query: 268 VVHNLKLYLSNIFSMKDLGHVTNYLGIHVEQ 360 +++ K + F MKDLG ++++LGI Q Sbjct: 848 ILNEFKENMKRHFKMKDLGQISHFLGIDFNQ 878 >SB_24294| Best HMM Match : RVT_2 (HMM E-Value=0) Length = 627 Score = 55.2 bits (127), Expect = 4e-08 Identities = 26/67 (38%), Positives = 44/67 (65%) Frame = +1 Query: 265 KVVHNLKLYLSNIFSMKDLGHVTNYLGIHVEQDLQNGIIKMSQNHYLRQILKKFNMCESK 444 K + +K LS F MKD+G + ++LG+ V Q + G + + Q+ Y++ +L+KF M SK Sbjct: 448 KRMTEVKQALSKQFKMKDMGKLHHFLGVKVIQKPETGELWIGQSTYVKGVLEKFGMENSK 507 Query: 445 PMSTPME 465 P+STP++ Sbjct: 508 PISTPVD 514 >SB_30586| Best HMM Match : RVT_2 (HMM E-Value=0.4) Length = 283 Score = 53.2 bits (122), Expect = 2e-07 Identities = 24/63 (38%), Positives = 39/63 (61%) Frame = +1 Query: 319 LGHVTNYLGIHVEQDLQNGIIKMSQNHYLRQILKKFNMCESKPMSTPMEFKFQMFQSNNS 498 +G ++ +LGI EQ G +KMSQ Y+ +IL++F M KP +TP E K ++ ++ Sbjct: 1 MGRLSYFLGIEFEQG--EGFVKMSQRKYVSKILERFQMSNCKPRATPSEQKLELCDQSSV 58 Query: 499 DPK 507 DP+ Sbjct: 59 DPR 61 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 522 RQILGSLMYAVLCTRPDLCPSVAYLIMGLN 611 R+ +GSL+YA+ CTRPD+C V L L+ Sbjct: 64 REAVGSLIYAMTCTRPDICWVVTKLSQHLS 93 >SB_45012| Best HMM Match : RVT_2 (HMM E-Value=1.2e-17) Length = 412 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +3 Query: 522 RQILGSLMYAVLCTRPDLCPSVAYLIMGLN 611 R+ +GSL+YA+ CTRPD+C V L L+ Sbjct: 229 REAVGSLIYAMTCTRPDICWVVTKLSQHLS 258 >SB_28383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.8 Identities = 21/98 (21%), Positives = 43/98 (43%) Frame = +1 Query: 241 HIDYGTNDKVVHNLKLYLSNIFSMKDLGHVTNYLGIHVEQDLQNGIIKMSQNHYLRQILK 420 ++ + + + H+L +YLS+ M V YL V++DL + + ++ + Sbjct: 34 YLSHSVDKDLSHSLDMYLSHNVDMYLSHSVDMYLSHSVDKDLSHSLDMYLSHNVDMYLSH 93 Query: 421 KFNMCESKPMSTPMEFKFQMFQSNNSDPK*KINVDKFL 534 +M S + + M+ S+N D +VD +L Sbjct: 94 NVDMYLSHNVDMYLSHSVDMYLSHNVDMYLSHSVDMYL 131 Score = 27.9 bits (59), Expect = 7.2 Identities = 24/95 (25%), Positives = 41/95 (43%), Gaps = 8/95 (8%) Frame = +1 Query: 274 HNLKLYLSNIFSM-------KDLGH-VTNYLGIHVEQDLQNGIIKMSQNHYLRQILKKFN 429 HN+++YLS+ M L H V YL V++DL + + ++ + + Sbjct: 5 HNVEMYLSHSVDMYLSHSVDMYLSHSVDMYLSHSVDKDLSHSLDMYLSHNVDMYLSHSVD 64 Query: 430 MCESKPMSTPMEFKFQMFQSNNSDPK*KINVDKFL 534 M S + + M+ S+N D NVD +L Sbjct: 65 MYLSHSVDKDLSHSLDMYLSHNVDMYLSHNVDMYL 99 >SB_20137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 29.1 bits (62), Expect = 3.1 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 6/72 (8%) Frame = +2 Query: 53 DDNVSVVKLNKSIYGLKKSPKYWNLKFDKVIAKKGFSRSEN------DFCLYCKVNCEYK 214 D+N + + K I+ + +S K W L F+ AK+ + +N D + K CEY Sbjct: 23 DENAECIAIRKDIFVVVQSFKKWTLCFE---AKEMYLEDQNKVPTLRDDPINTKFACEYG 79 Query: 215 IYLLLFVDDILI 250 + +L D+ LI Sbjct: 80 VATILCDDNRLI 91 >SB_6883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 29.1 bits (62), Expect = 3.1 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 116 YWNLKFDKVIAKKGFSRSENDFCLYCKVNCEYKIYLLLFV 235 Y+N++ V+ ++ + +CKVNC ++L LF+ Sbjct: 794 YYNIR-KMVLTRRNCAHDAKGKLFHCKVNCYRAVFLFLFI 832 >SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 28.7 bits (61), Expect = 4.1 Identities = 9/29 (31%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = -2 Query: 98 VHIYFCLISQHLHCHHIQV-VVSYKHLPV 15 ++I L+S + HCHH Q+ +++++H+ + Sbjct: 338 INILPLLLSTYYHCHHQQITIINHQHIAI 366 >SB_21157| Best HMM Match : Laminin_EGF (HMM E-Value=0.036) Length = 897 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 116 YWNLKFDKVIAKKGFSRSENDFCLYCKVNCEYKIYLLLFV 235 Y+N++ K++ K D CKVNC ++L LF+ Sbjct: 388 YYNVR--KMVLTKICHHDAKDTLFDCKVNCYRAVFLFLFI 425 >SB_41336| Best HMM Match : Laminin_EGF (HMM E-Value=0.036) Length = 367 Score = 28.3 bits (60), Expect = 5.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 116 YWNLKFDKVIAKKGFSRSENDFCLYCKVNCEYKIYLLLFV 235 Y+N++ K++ K D CKVNC ++L LF+ Sbjct: 303 YYNVR--KMVLTKICHHDAKDTLFDCKVNCYRAVFLFLFI 340 >SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4538 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 259 NDKVVHNLKLYLSNIFSMKDLGHVTNY 339 NDKV NLKL + ++ K++G V+ Y Sbjct: 2636 NDKVSPNLKLSIESVCDEKNIGKVSYY 2662 >SB_25313| Best HMM Match : REJ (HMM E-Value=0.012) Length = 379 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 259 NDKVVHNLKLYLSNIFSMKDLGHVTNY 339 NDKV NLKL + ++ K++G V+ Y Sbjct: 7 NDKVSPNLKLSIESVCDEKNIGKVSYY 33 >SB_14489| Best HMM Match : DUF789 (HMM E-Value=5.6) Length = 382 Score = 27.9 bits (59), Expect = 7.2 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +1 Query: 361 DLQNGIIKMSQNHYLRQILKKFNMCESKPMSTPMEFKFQMFQSNNSDPK 507 D+Q+ + KM + H LKK+N C T +E + N+SDPK Sbjct: 277 DVQDQLAKMGELHMRTPTLKKYNYCGP---GTKLEMRL-----NSSDPK 317 >SB_806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 98 VHIYFCLISQHLHCHHIQVVVSYKHLPVYLH 6 VHIY I H++ HI+V + KH+ V+++ Sbjct: 70 VHIYDKHIRIHIYDKHIRVHIYNKHIRVHIY 100 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,456,599 Number of Sequences: 59808 Number of extensions: 329966 Number of successful extensions: 714 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 710 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -