BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1086 (344 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 0.60 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 22 5.6 DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 22 7.4 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 22 7.4 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.4 bits (53), Expect = 0.60 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 36 SCTRPSGRWCEXPSAGLCL 92 SC RP G C P G C+ Sbjct: 594 SCDRPGGLLCSGPDHGRCV 612 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 277 C*EKNR*HDLRDPNGLRRRVSRFECETR 194 C +N + PN +RR + F C+ R Sbjct: 374 CRRRNTLGGAQTPNAAQRRSTGFRCQQR 401 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 21.8 bits (44), Expect = 7.4 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 150 EPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSCYRFFS 272 + R GSK S + S+ E RR+P RS F S Sbjct: 106 DARPRFGSKAAAANSSATSSESEDERRTPPQDMRSMAGFRS 146 Score = 21.8 bits (44), Expect = 7.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 205 IQNARRDVEAHLDRGDRAIGFF 270 +Q +EAHL +G AIG + Sbjct: 191 LQGISAPIEAHLRKGRGAIGAY 212 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -2 Query: 88 HNPADGXSHHRPLGRVHEPNVRNCGS 11 H+P +G ++ P G + P N G+ Sbjct: 373 HSPVNGYGNNHPTGGSNLPGNNNGGA 398 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 360,856 Number of Sequences: 2352 Number of extensions: 6171 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 24505155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -