BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1086 (344 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 1.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 1.3 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 5.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 20 7.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 7.2 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.0 bits (47), Expect = 1.0 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 66 RTTGRSAECMNQMSETAVPLLL 1 + G+ +C N MSE V +LL Sbjct: 170 KENGKEFDCHNYMSELTVDILL 191 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.6 bits (46), Expect = 1.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 202 RIQNARRDVEAHLDRGDRAIGFF 270 ++Q VEAHL +G AIG + Sbjct: 180 QLQGISTPVEAHLRKGRGAIGAY 202 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 20.6 bits (41), Expect = 5.4 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +3 Query: 204 HSKRETRRRSPFGSRRSCYRFFS*HVHHGS 293 H K RR S + Y + HVHH + Sbjct: 256 HQKELVRRDSRRKNYGGVYHLDNHHVHHAN 285 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 20.2 bits (40), Expect = 7.2 Identities = 12/50 (24%), Positives = 22/50 (44%) Frame = +3 Query: 108 EASLAESGKDMLTVEPRESGGSKQCDFTSRVSHSKRETRRRSPFGSRRSC 257 E+ LAES + + + G K+C+ + + + R+ P R C Sbjct: 69 ESYLAESSRSIDPCASKYCGIGKECELSPNSTIAVCVCMRKCPRRHRPVC 118 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.2 bits (40), Expect = 7.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 180 CDFTSRVSHSKRETRRRSP 236 CD V HS ++T+++ P Sbjct: 1487 CDSKLIVDHSSQKTQQQQP 1505 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,415 Number of Sequences: 438 Number of extensions: 1733 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 7812315 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -