BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fbVf1076 (614 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68333-4|CAA92723.2| 271|Caenorhabditis elegans Hypothetical pr... 30 1.1 U61948-5|AAB03149.2| 509|Caenorhabditis elegans Hypothetical pr... 28 4.6 >Z68333-4|CAA92723.2| 271|Caenorhabditis elegans Hypothetical protein C05C12.4 protein. Length = 271 Score = 30.3 bits (65), Expect = 1.1 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 286 CKL*FYSVSR*EIYKCQLGESRAILLRPEIKNPY 185 CK +Y S EI+ C +GE R + EI+N Y Sbjct: 53 CKYGYYGPSCFEIFDCVIGELREDICSDEIENDY 86 >U61948-5|AAB03149.2| 509|Caenorhabditis elegans Hypothetical protein C46A5.2 protein. Length = 509 Score = 28.3 bits (60), Expect = 4.6 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = -1 Query: 611 NVISKILWNSGVLLHIGWSDGEQLLCIQESGDVLIMTCLEL 489 +++SK+ W ++ GWS G + +++ GD T L + Sbjct: 98 SLMSKVFWAIVIMACAGWSIGNTISILKQYGDEATTTLLTI 138 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,254,298 Number of Sequences: 27780 Number of extensions: 324922 Number of successful extensions: 907 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 907 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -